eF-site ID 1o0r-A PDB Code 1o0r Chain A click to enlarge Title Crystal structure of the catalytic domain of bovine beta1,4-galactosyltransferase complex with UDP-galactose Classification TRANSFERASE Compound beta-1,4-galactosyltransferase Source Bos taurus (Bovine) (B4GT1_BOVIN) Sequence A:  TACPEESPLLVGPMLIEFNIPVDLKLVEQQNPKVKLGGRY TPMDCISPHKVAIIIPFRNRQEHLKYWLYYLHPILQRQQL DYGIYVINQAGESMFNRAKLLNVGFKEALKDYDYNCFVFS DVDLIPMNDHNTYRCFSQPRHISVAMDKFGFSLPYVQYFG GVSALSKQQFLSINGFPNNYWGWGGEDDDIYNRLAFRGMS VSRPNAVIGKTRMIRHSRDKKNEPNPQRFDRIAHTKETML SDGLNSLTYMVLEVQRYPLYTKITVDIGTPS Description Functional site 1) chain A residue 187 type sequence P description BINDING SITE FOR RESIDUE GDU A 404 source : AC1 2) chain A residue 188 type sequence F description BINDING SITE FOR RESIDUE GDU A 404 source : AC1 3) chain A residue 189 type sequence R description BINDING SITE FOR RESIDUE GDU A 404 source : AC1 4) chain A residue 191 type sequence R description BINDING SITE FOR RESIDUE GDU A 404 source : AC1 5) chain A residue 226 type sequence F description BINDING SITE FOR RESIDUE GDU A 404 source : AC1 6) chain A residue 228 type sequence R description BINDING SITE FOR RESIDUE GDU A 404 source : AC1 7) chain A residue 252 type sequence D description BINDING SITE FOR RESIDUE GDU A 404 source : AC1 8) chain A residue 253 type sequence V description BINDING SITE FOR RESIDUE GDU A 404 source : AC1 9) chain A residue 254 type sequence D description BINDING SITE FOR RESIDUE GDU A 404 source : AC1 10) chain A residue 279 type sequence K description BINDING SITE FOR RESIDUE GDU A 404 source : AC1 11) chain A residue 289 type sequence Y description BINDING SITE FOR RESIDUE GDU A 404 source : AC1 12) chain A residue 292 type sequence G description BINDING SITE FOR RESIDUE GDU A 404 source : AC1 13) chain A residue 314 type sequence W description BINDING SITE FOR RESIDUE GDU A 404 source : AC1 14) chain A residue 315 type sequence G description BINDING SITE FOR RESIDUE GDU A 404 source : AC1 15) chain A residue 317 type sequence E description BINDING SITE FOR RESIDUE GDU A 404 source : AC1 16) chain A residue 344 type sequence M description BINDING SITE FOR RESIDUE GDU A 404 source : AC1 17) chain A residue 347 type sequence H description BINDING SITE FOR RESIDUE GDU A 404 source : AC1 18) chain A residue 350 type sequence D description BINDING SITE FOR RESIDUE GDU A 404 source : AC1 19) chain A residue 254 type sequence D description BINDING SITE FOR RESIDUE MN A 403 source : AC4 20) chain A residue 344 type sequence M description BINDING SITE FOR RESIDUE MN A 403 source : AC4 21) chain A residue 347 type sequence H description BINDING SITE FOR RESIDUE MN A 403 source : AC4 22) chain A residue 265 type sequence R description BINDING SITE FOR RESIDUE SO4 A 903 source : AC7 23) chain A residue 266 type sequence C description BINDING SITE FOR RESIDUE SO4 A 903 source : AC7 24) chain A residue 267 type sequence F description BINDING SITE FOR RESIDUE SO4 A 903 source : AC7 25) chain A residue 268 type sequence S description BINDING SITE FOR RESIDUE SO4 A 903 source : AC7 26) chain A residue 221 type sequence A description BINDING SITE FOR RESIDUE MES A 900 source : AC9 27) chain A residue 222 type sequence G description BINDING SITE FOR RESIDUE MES A 900 source : AC9 28) chain A residue 223 type sequence E description BINDING SITE FOR RESIDUE MES A 900 source : AC9 29) chain A residue 383 type sequence L description BINDING SITE FOR RESIDUE MES A 900 source : AC9 30) chain A residue 384 type sequence E description BINDING SITE FOR RESIDUE MES A 900 source : AC9 31) chain A residue 395 type sequence T description BINDING SITE FOR RESIDUE MES A 900 source : AC9 32) chain A residue 155 type sequence L description BINDING SITE FOR RESIDUE DIO A 905 source : BC1 33) chain A residue 388 type sequence Y description BINDING SITE FOR RESIDUE DIO A 905 source : BC1 34) chain A residue 325 type catalytic sequence L description 570 source MCSA : MCSA1 35) chain A residue 327 type catalytic sequence F description 570 source MCSA : MCSA1 36) chain A residue 387 type catalytic sequence R description 570 source MCSA : MCSA1 37) chain A residue 390 type catalytic sequence L description 570 source MCSA : MCSA1 38) chain A residue 391 type catalytic sequence Y description 570 source MCSA : MCSA1 39) chain A residue 260 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI1 40) chain A residue 299 type BINDING sequence Q description source Swiss-Prot : SWS_FT_FI1 41) chain A residue 326 type BINDING sequence A description source Swiss-Prot : SWS_FT_FI1 42) chain A residue 327 type BINDING sequence F description source Swiss-Prot : SWS_FT_FI1 43) chain A residue 387 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI1 44) chain A residue 389 type BINDING sequence P description source Swiss-Prot : SWS_FT_FI1 45) chain A residue 163 type CARBOHYD sequence P description N-linked (GlcNAc...) asparagine => ECO:0000305|PubMed:2117606 source Swiss-Prot : SWS_FT_FI2 46) chain A residue 190 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine => ECO:0000255 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links