eF-site ID 1nx4-C PDB Code 1nx4 Chain C click to enlarge Title The crystal structure of carbapenem synthase (CarC) Classification UNKNOWN FUNCTION Compound Carbapenem synthase Source Erwinia carotovora (Q9XB59_ERWCA) Sequence C:  SEIVKFNPVXASGFGAYIDHRDFLEAKTETIKNLLXRQGF VVVKNLDIDSDTFRDIYSAYGTIVEYADTLKLEGEKGKIV TGRGQLPFHADGGLLLSQVDQVFLYAAEIKNVKFRGATTV CDHALACQEXPAHLLRVLEEETFEVRVLEWFKVPVFTDLG WVRKXLIYFPFDEGQPASWEPRIVGFTDHETQAFFQELGA FLKQPRYYYKHFWEDGDLLIXDNRRVIHEREEFNDDDIVR RLYRGQTADI Description (1)  Carbapenem synthase Functional site 1) chain C residue 101 type sequence H description BINDING SITE FOR RESIDUE FE C 300 source : AC3 2) chain C residue 103 type sequence D description BINDING SITE FOR RESIDUE FE C 300 source : AC3 3) chain C residue 251 type sequence H description BINDING SITE FOR RESIDUE FE C 300 source : AC3 4) chain C residue 101 type sequence H description BINDING SITE FOR RESIDUE AKG C 282 source : AC6 5) chain C residue 103 type sequence D description BINDING SITE FOR RESIDUE AKG C 282 source : AC6 6) chain C residue 130 type sequence T description BINDING SITE FOR RESIDUE AKG C 282 source : AC6 7) chain C residue 251 type sequence H description BINDING SITE FOR RESIDUE AKG C 282 source : AC6 8) chain C residue 253 type sequence R description BINDING SITE FOR RESIDUE AKG C 282 source : AC6 9) chain C residue 263 type sequence R description BINDING SITE FOR RESIDUE AKG C 282 source : AC6 10) chain C residue 265 type sequence L description BINDING SITE FOR RESIDUE AKG C 282 source : AC6 11) chain C residue 267 type sequence R description BINDING SITE FOR RESIDUE AKG C 282 source : AC6 12) chain C residue 101 type BINDING sequence H description BINDING => ECO:0000269|PubMed:12611886 source Swiss-Prot : SWS_FT_FI1 13) chain C residue 103 type BINDING sequence D description BINDING => ECO:0000269|PubMed:12611886 source Swiss-Prot : SWS_FT_FI1 14) chain C residue 251 type BINDING sequence H description BINDING => ECO:0000269|PubMed:12611886 source Swiss-Prot : SWS_FT_FI1 15) chain C residue 104 type BINDING sequence G description BINDING => ECO:0000255 source Swiss-Prot : SWS_FT_FI2 16) chain C residue 253 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI3 17) chain C residue 263 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI3 18) chain C residue 267 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI3 19) chain C residue 130 type BINDING sequence T description source Swiss-Prot : SWS_FT_FI3

Display surface Download Links