eF-site ID 1nx4-A PDB Code 1nx4 Chain A click to enlarge Title The crystal structure of carbapenem synthase (CarC) Classification UNKNOWN FUNCTION Compound Carbapenem synthase Source Erwinia carotovora (Q9XB59_ERWCA) Sequence A:  SEIVKFNPVXASGFGAYIDHRDFLEAKTETIKNLLXRQGF VVVKNLDIDSDTFRDIYSAYGTIVERDTLKLEGEKGKIVT GRGQLPFHADGGLLLSQVDQVFLYAAEIKNVKFRGATTVC DHALACQEXPAHLLRVLEEETFEVRVLWFKVPVFTDLGWV RKXLIYFPFDEGQPASWEPRIVGFTDHETQAFFQELGAFL KQPRYYYKHFWEDGDLLIXDNRRVIHEREEFNDDDIVRRL YRGQTAD Description (1)  Carbapenem synthase Functional site 1) chain A residue 101 type sequence H description BINDING SITE FOR RESIDUE FE A 300 source : AC1 2) chain A residue 103 type sequence D description BINDING SITE FOR RESIDUE FE A 300 source : AC1 3) chain A residue 251 type sequence H description BINDING SITE FOR RESIDUE FE A 300 source : AC1 4) chain A residue 84 type sequence L description BINDING SITE FOR RESIDUE AKG A 280 source : AC4 5) chain A residue 92 type sequence V description BINDING SITE FOR RESIDUE AKG A 280 source : AC4 6) chain A residue 101 type sequence H description BINDING SITE FOR RESIDUE AKG A 280 source : AC4 7) chain A residue 103 type sequence D description BINDING SITE FOR RESIDUE AKG A 280 source : AC4 8) chain A residue 130 type sequence T description BINDING SITE FOR RESIDUE AKG A 280 source : AC4 9) chain A residue 251 type sequence H description BINDING SITE FOR RESIDUE AKG A 280 source : AC4 10) chain A residue 253 type sequence R description BINDING SITE FOR RESIDUE AKG A 280 source : AC4 11) chain A residue 263 type sequence R description BINDING SITE FOR RESIDUE AKG A 280 source : AC4 12) chain A residue 267 type sequence R description BINDING SITE FOR RESIDUE AKG A 280 source : AC4 13) chain A residue 101 type BINDING sequence H description BINDING => ECO:0000269|PubMed:12611886 source Swiss-Prot : SWS_FT_FI1 14) chain A residue 103 type BINDING sequence D description BINDING => ECO:0000269|PubMed:12611886 source Swiss-Prot : SWS_FT_FI1 15) chain A residue 251 type BINDING sequence H description BINDING => ECO:0000269|PubMed:12611886 source Swiss-Prot : SWS_FT_FI1 16) chain A residue 104 type BINDING sequence G description BINDING => ECO:0000255 source Swiss-Prot : SWS_FT_FI2 17) chain A residue 130 type BINDING sequence T description source Swiss-Prot : SWS_FT_FI3 18) chain A residue 253 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI3 19) chain A residue 263 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI3 20) chain A residue 267 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI3

Display surface Download Links