eF-site ID 1nvu-R PDB Code 1nvu Chain R click to enlarge Title Structural evidence for feedback activation by RasGTP of the Ras-specific nucleotide exchange factor SOS Classification SIGNALING PROTEIN Compound Transforming protein p21/H-RAS-1 Source Homo sapiens (Human) (SOS1_HUMAN) Sequence R:  MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSY RKQVVIDGETCLLDILDTGGQEEYSAMRDQYMRTGEGFLC VFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLV REIRQH Description Functional site 1) chain R residue 13 type sequence G description BINDING SITE FOR RESIDUE PO4 R 1003 source : AC2 2) chain R residue 14 type sequence V description BINDING SITE FOR RESIDUE PO4 R 1003 source : AC2 3) chain R residue 15 type sequence G description BINDING SITE FOR RESIDUE PO4 R 1003 source : AC2 4) chain R residue 16 type sequence K description BINDING SITE FOR RESIDUE PO4 R 1003 source : AC2 5) chain R residue 17 type sequence S description BINDING SITE FOR RESIDUE PO4 R 1003 source : AC2 6) chain R residue 59 type sequence G description BINDING SITE FOR RESIDUE PO4 R 1003 source : AC2 7) chain R residue 62 type sequence E description BINDING SITE FOR RESIDUE PO4 R 1003 source : AC2 8) chain R residue 63 type sequence E description BINDING SITE FOR RESIDUE PO4 S 1048 source : AC4 9) chain R residue 127 type sequence S description BINDING SITE FOR RESIDUE PO4 S 1048 source : AC4 10) chain R residue 128 type sequence R description BINDING SITE FOR RESIDUE PO4 S 1048 source : AC4 11) chain R residue 131 type sequence Q description BINDING SITE FOR RESIDUE PO4 S 1048 source : AC4 12) chain R residue 145 type BINDING sequence S description BINDING => ECO:0000269|PubMed:16698776 source Swiss-Prot : SWS_FT_FI1 13) chain R residue 13 type BINDING sequence G description BINDING => ECO:0000269|PubMed:16698776 source Swiss-Prot : SWS_FT_FI1 14) chain R residue 29 type BINDING sequence V description BINDING => ECO:0000269|PubMed:16698776 source Swiss-Prot : SWS_FT_FI1 15) chain R residue 59 type BINDING sequence G description BINDING => ECO:0000269|PubMed:16698776 source Swiss-Prot : SWS_FT_FI1 16) chain R residue 116 type BINDING sequence N description BINDING => ECO:0000269|PubMed:16698776 source Swiss-Prot : SWS_FT_FI1 17) chain R residue 1 type MOD_RES sequence M description N-acetylmethionine; in GTPase HRas; alternate => ECO:0000269|Ref.12 source Swiss-Prot : SWS_FT_FI2 18) chain R residue 2 type MOD_RES sequence T description N-acetylthreonine; in GTPase HRas, N-terminally processed => ECO:0000269|Ref.12 source Swiss-Prot : SWS_FT_FI3 19) chain R residue 118 type MOD_RES sequence C description S-nitrosocysteine => ECO:0000269|PubMed:9020151 source Swiss-Prot : SWS_FT_FI4 20) chain R residue 35 type CARBOHYD sequence T description (Microbial infection) O-linked (Glc) threonine; by P.sordellii toxin TcsL => ECO:0000269|PubMed:19744486, ECO:0000269|PubMed:8626575, ECO:0000269|PubMed:8626586, ECO:0000269|PubMed:9632667 source Swiss-Prot : SWS_FT_FI5

Display surface Download Links