eF-site ID 1nvu-QRS PDB Code 1nvu Chain Q, R, S click to enlarge Title Structural evidence for feedback activation by RasGTP of the Ras-specific nucleotide exchange factor SOS Classification SIGNALING PROTEIN Compound Transforming protein p21/H-RAS-1 Source null (SOS1_HUMAN) Sequence Q:  MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSY RKQVVIDGETCLLDILDTGGQEEYSAMRDQYMRTGEGFLC VFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLV REIRQH R:  MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSY RKQVVIDGETCLLDILDTGGQEEYSAMRDQYMRTGEGFLC VFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLV REIRQH S:  QMRLPSADVYRFAEPDSEENIIFEEGIPIIKAGTVIKLIE RLTYHMYADPNFVRTFLTTYRSFCKPQELLSLIIERFEIP EPEPTEADRIAIENGDQPLSAELKRFRKEYIQPVQLRVLN VCRHWVEHHFYDFERDAYLLQRMEEFIGTVRGKAMKKWVE SITKIIQRKKIAHNITFQSSPPTVEWHISRPGHIETFDLL TLHPIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEIN SPNLLKMIRHTTNLTLWFEKCIVETENLEERVAVVSRIIE ILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQ KKILEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNI LKTEEGNPEVLKRHGKELINFSKRRKVAEITGEIQQYQNQ PYCLRVESDIKRFFENLNPMGNSMEKEFTDYLFNKSLEIE PRNPKPLPRFPKKYSYPLKSPGVRPSNPR Description Functional site 1) chain Q residue 17 type sequence S description BINDING SITE FOR RESIDUE MG Q 1002 source : AC1 2) chain Q residue 35 type sequence T description BINDING SITE FOR RESIDUE MG Q 1002 source : AC1 3) chain R residue 13 type sequence G description BINDING SITE FOR RESIDUE PO4 R 1003 source : AC2 4) chain R residue 14 type sequence V description BINDING SITE FOR RESIDUE PO4 R 1003 source : AC2 5) chain R residue 15 type sequence G description BINDING SITE FOR RESIDUE PO4 R 1003 source : AC2 6) chain R residue 16 type sequence K description BINDING SITE FOR RESIDUE PO4 R 1003 source : AC2 7) chain R residue 17 type sequence S description BINDING SITE FOR RESIDUE PO4 R 1003 source : AC2 8) chain R residue 59 type sequence G description BINDING SITE FOR RESIDUE PO4 R 1003 source : AC2 9) chain R residue 62 type sequence E description BINDING SITE FOR RESIDUE PO4 R 1003 source : AC2 10) chain S residue 625 type sequence R description BINDING SITE FOR RESIDUE PO4 S 1047 source : AC3 11) chain S residue 695 type sequence H description BINDING SITE FOR RESIDUE PO4 S 1047 source : AC3 12) chain S residue 699 type sequence H description BINDING SITE FOR RESIDUE PO4 S 1047 source : AC3 13) chain S residue 700 type sequence H description BINDING SITE FOR RESIDUE PO4 S 1047 source : AC3 14) chain R residue 63 type sequence E description BINDING SITE FOR RESIDUE PO4 S 1048 source : AC4 15) chain R residue 127 type sequence S description BINDING SITE FOR RESIDUE PO4 S 1048 source : AC4 16) chain R residue 128 type sequence R description BINDING SITE FOR RESIDUE PO4 S 1048 source : AC4 17) chain R residue 131 type sequence Q description BINDING SITE FOR RESIDUE PO4 S 1048 source : AC4 18) chain S residue 814 type sequence K description BINDING SITE FOR RESIDUE PO4 S 1048 source : AC4 19) chain S residue 815 type sequence E description BINDING SITE FOR RESIDUE PO4 S 1048 source : AC4 20) chain S residue 826 type sequence R description BINDING SITE FOR RESIDUE PO4 S 1048 source : AC4 21) chain S residue 660 type sequence R description BINDING SITE FOR RESIDUE PO4 S 1049 source : AC5 22) chain S residue 709 type sequence Y description BINDING SITE FOR RESIDUE PO4 S 1049 source : AC5 23) chain S residue 716 type sequence E description BINDING SITE FOR RESIDUE PO4 S 1049 source : AC5 24) chain S residue 951 type sequence H description BINDING SITE FOR RESIDUE PO4 S 1049 source : AC5 25) chain Q residue 153 type sequence E description BINDING SITE FOR RESIDUE PO4 Q 1007 source : AC6 26) chain Q residue 154 type sequence D description BINDING SITE FOR RESIDUE PO4 Q 1007 source : AC6 27) chain Q residue 157 type sequence Y description BINDING SITE FOR RESIDUE PO4 Q 1007 source : AC6 28) chain Q residue 161 type sequence R description BINDING SITE FOR RESIDUE PO4 Q 1007 source : AC6 29) chain Q residue 12 type sequence G description BINDING SITE FOR RESIDUE GTP Q 1001 source : AC7 30) chain Q residue 13 type sequence G description BINDING SITE FOR RESIDUE GTP Q 1001 source : AC7 31) chain Q residue 14 type sequence V description BINDING SITE FOR RESIDUE GTP Q 1001 source : AC7 32) chain Q residue 15 type sequence G description BINDING SITE FOR RESIDUE GTP Q 1001 source : AC7 33) chain Q residue 16 type sequence K description BINDING SITE FOR RESIDUE GTP Q 1001 source : AC7 34) chain Q residue 17 type sequence S description BINDING SITE FOR RESIDUE GTP Q 1001 source : AC7 35) chain Q residue 18 type sequence A description BINDING SITE FOR RESIDUE GTP Q 1001 source : AC7 36) chain Q residue 28 type sequence F description BINDING SITE FOR RESIDUE GTP Q 1001 source : AC7 37) chain Q residue 29 type sequence V description BINDING SITE FOR RESIDUE GTP Q 1001 source : AC7 38) chain Q residue 30 type sequence D description BINDING SITE FOR RESIDUE GTP Q 1001 source : AC7 39) chain Q residue 32 type sequence Y description BINDING SITE FOR RESIDUE GTP Q 1001 source : AC7 40) chain Q residue 34 type sequence P description BINDING SITE FOR RESIDUE GTP Q 1001 source : AC7 41) chain Q residue 35 type sequence T description BINDING SITE FOR RESIDUE GTP Q 1001 source : AC7 42) chain Q residue 60 type sequence G description BINDING SITE FOR RESIDUE GTP Q 1001 source : AC7 43) chain Q residue 62 type sequence E description BINDING SITE FOR RESIDUE GTP Q 1001 source : AC7 44) chain Q residue 116 type sequence N description BINDING SITE FOR RESIDUE GTP Q 1001 source : AC7 45) chain Q residue 117 type sequence K description BINDING SITE FOR RESIDUE GTP Q 1001 source : AC7 46) chain Q residue 119 type sequence D description BINDING SITE FOR RESIDUE GTP Q 1001 source : AC7 47) chain Q residue 120 type sequence L description BINDING SITE FOR RESIDUE GTP Q 1001 source : AC7 48) chain Q residue 145 type sequence S description BINDING SITE FOR RESIDUE GTP Q 1001 source : AC7 49) chain Q residue 146 type sequence A description BINDING SITE FOR RESIDUE GTP Q 1001 source : AC7 50) chain Q residue 147 type sequence K description BINDING SITE FOR RESIDUE GTP Q 1001 source : AC7 51) chain Q residue 13 type BINDING sequence G description BINDING => ECO:0000269|PubMed:16698776 source Swiss-Prot : SWS_FT_FI1 52) chain Q residue 29 type BINDING sequence V description BINDING => ECO:0000269|PubMed:16698776 source Swiss-Prot : SWS_FT_FI1 53) chain Q residue 59 type BINDING sequence G description BINDING => ECO:0000269|PubMed:16698776 source Swiss-Prot : SWS_FT_FI1 54) chain Q residue 116 type BINDING sequence N description BINDING => ECO:0000269|PubMed:16698776 source Swiss-Prot : SWS_FT_FI1 55) chain Q residue 145 type BINDING sequence S description BINDING => ECO:0000269|PubMed:16698776 source Swiss-Prot : SWS_FT_FI1 56) chain R residue 13 type BINDING sequence G description BINDING => ECO:0000269|PubMed:16698776 source Swiss-Prot : SWS_FT_FI1 57) chain R residue 29 type BINDING sequence V description BINDING => ECO:0000269|PubMed:16698776 source Swiss-Prot : SWS_FT_FI1 58) chain R residue 145 type BINDING sequence S description BINDING => ECO:0000269|PubMed:16698776 source Swiss-Prot : SWS_FT_FI1 59) chain R residue 59 type BINDING sequence G description BINDING => ECO:0000269|PubMed:16698776 source Swiss-Prot : SWS_FT_FI1 60) chain R residue 116 type BINDING sequence N description BINDING => ECO:0000269|PubMed:16698776 source Swiss-Prot : SWS_FT_FI1 61) chain Q residue 1 type MOD_RES sequence M description N-acetylmethionine; in GTPase HRas; alternate => ECO:0000269|Ref.12 source Swiss-Prot : SWS_FT_FI2 62) chain R residue 1 type MOD_RES sequence M description N-acetylmethionine; in GTPase HRas; alternate => ECO:0000269|Ref.12 source Swiss-Prot : SWS_FT_FI2 63) chain Q residue 2 type MOD_RES sequence T description N-acetylthreonine; in GTPase HRas, N-terminally processed => ECO:0000269|Ref.12 source Swiss-Prot : SWS_FT_FI3 64) chain R residue 2 type MOD_RES sequence T description N-acetylthreonine; in GTPase HRas, N-terminally processed => ECO:0000269|Ref.12 source Swiss-Prot : SWS_FT_FI3 65) chain Q residue 118 type MOD_RES sequence C description S-nitrosocysteine => ECO:0000269|PubMed:9020151 source Swiss-Prot : SWS_FT_FI4 66) chain R residue 118 type MOD_RES sequence C description S-nitrosocysteine => ECO:0000269|PubMed:9020151 source Swiss-Prot : SWS_FT_FI4 67) chain Q residue 35 type CARBOHYD sequence T description (Microbial infection) O-linked (Glc) threonine; by P.sordellii toxin TcsL => ECO:0000269|PubMed:19744486, ECO:0000269|PubMed:8626575, ECO:0000269|PubMed:8626586, ECO:0000269|PubMed:9632667 source Swiss-Prot : SWS_FT_FI5 68) chain R residue 35 type CARBOHYD sequence T description (Microbial infection) O-linked (Glc) threonine; by P.sordellii toxin TcsL => ECO:0000269|PubMed:19744486, ECO:0000269|PubMed:8626575, ECO:0000269|PubMed:8626586, ECO:0000269|PubMed:9632667 source Swiss-Prot : SWS_FT_FI5 69) chain S residue 927-960 type prosite sequence VPFFGIYLTNILKTEEGNPEVLKRHGKELINFSK description RASGEF Ras Guanine-nucleotide exchange factors domain signature. VPFfGiyLtNIlkteegnpevlkrhgkel.................INFsK source prosite : PS00720

Display surface Download Links