eF-site ID 1nmc-L
PDB Code 1nmc
Chain L

click to enlarge
Title COMPLEX BETWEEN NC10 ANTI-INFLUENZA VIRUS NEURAMINIDASE SINGLE CHAIN ANTIBODY WITH A 15 RESIDUE LINKER AND INFLUENZA VIRUS NEURAMINIDASE
Classification COMPLEX (SINGLE-CHAIN ANTIBODY/ANTIGEN)
Compound NEURAMINIDASE
Source Influenza A virus (strain A/Tern/Australia/G70C/1975 H11N9) (AAA19165)
Sequence L:  DIELTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQNP
DGTVKLLIYYTSNLHSEVPSRFSGSGSGTDYSLTISNLEQ
EDIATYFCQQDFTLPFTFGGGTKLEIRDY
Description (1)  NEURAMINIDASE, SINGLE CHAIN ANTIBODY

Display surface

Download
Links