eF-site ID 1nmc-HLN
PDB Code 1nmc
Chain H, L, N

click to enlarge
Title COMPLEX BETWEEN NC10 ANTI-INFLUENZA VIRUS NEURAMINIDASE SINGLE CHAIN ANTIBODY WITH A 15 RESIDUE LINKER AND INFLUENZA VIRUS NEURAMINIDASE
Classification COMPLEX (SINGLE-CHAIN ANTIBODY/ANTIGEN)
Compound NEURAMINIDASE
Source (AAA19165)
Sequence H:  QVQLQQSGAELVKPGASVRMSCKASGYTFTNYNMYWVKQS
PGQGLEWIGIFYPGNGDTSYNQKFKDKATLTADKSSNTAY
MQLSSLTSEDSAVYYCARSGGSYRYDGGFDYWGQGTTVTV
SS
L:  DIELTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQNP
DGTVKLLIYYTSNLHSEVPSRFSGSGSGTDYSLTISNLEQ
EDIATYFCQQDFTLPFTFGGGTKLEIRDY
N:  RDFNNLTKGLCTINSWHIYGKDNAVRIGEDSDVLVTREPY
VSCDPDECRFYALSQGTTIRGKHSNGTIHDRSQYRALISW
PLSSPPTVYNSRVECIGWSSTSCHDGKTRMSICISGPNNN
ASAVIWYNRRPVTEINTWARNILRTQESECVCHNGVCPVV
FTDGSATGPAETRIYYFKEGKILKWEPLAGTAKHIEECSC
YGERAEITCTCRDNWQGSNRPVIRIDPVAMTHTSQYICSP
VLTDNPRPNDPTVGKCNDPYPGNNNNGVKGFSYLDGVNTW
LGRTISIASRSGYEMLKVPNALTDDKSKPTQGQTIVLNTD
WSGYSGSFMDYWAEGECYRACFYVELIRGRPKEDKVWWTS
NSIVSMCSSTEFLGQWDWPDGAKIEYFL
Description (1)  NEURAMINIDASE, SINGLE CHAIN ANTIBODY


Functional site

1) chain N
residue 200
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NAG N 469A
source : AC1

2) chain N
residue 220
type
ligand
sequence R
description BINDING SITE FOR RESIDUE NAG N 469A
source : AC1

3) chain N
residue 453
type
ligand
sequence L
description BINDING SITE FOR RESIDUE NAG N 469A
source : AC1

4) chain N
residue 454
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NAG N 469A
source : AC1

5) chain N
residue 455
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE NAG N 469A
source : AC1

6) chain N
residue 392
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE NAG N 470B
source : AC2

7) chain N
residue 394
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NAG N 470B
source : AC2

8) chain N
residue 452
type
ligand
sequence F
description BINDING SITE FOR RESIDUE NAG N 470B
source : AC2

9) chain N
residue 377
type
ligand
sequence L
description BINDING SITE FOR RESIDUE BMA N 471C
source : AC3

10) chain N
residue 391
type
ligand
sequence T
description BINDING SITE FOR RESIDUE BMA N 471C
source : AC3

11) chain N
residue 394
type
ligand
sequence G
description BINDING SITE FOR RESIDUE BMA N 471C
source : AC3

12) chain N
residue 364
type
ligand
sequence R
description BINDING SITE FOR RESIDUE MAN N 472D
source : AC4

13) chain N
residue 375
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MAN N 472D
source : AC4

14) chain N
residue 330
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MAN N 473E
source : AC5

15) chain N
residue 389
type
ligand
sequence K
description BINDING SITE FOR RESIDUE MAN N 473E
source : AC5

16) chain N
residue 390
type
ligand
sequence P
description BINDING SITE FOR RESIDUE MAN N 473E
source : AC5

17) chain H
residue 100
type
ligand
sequence R
description BINDING SITE FOR RESIDUE MAN N 474F
source : AC6

18) chain N
residue 327
type
ligand
sequence R
description BINDING SITE FOR RESIDUE MAN N 474F
source : AC6

19) chain N
residue 329
type
ligand
sequence N
description BINDING SITE FOR RESIDUE MAN N 474F
source : AC6

20) chain N
residue 330
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MAN N 474F
source : AC6

21) chain N
residue 364
type
ligand
sequence R
description BINDING SITE FOR RESIDUE MAN N 474F
source : AC6

22) chain N
residue 366
type
ligand
sequence I
description BINDING SITE FOR RESIDUE MAN N 474F
source : AC6

23) chain N
residue 146
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NAG N 476A
source : AC8

24) chain N
residue 437
type
ligand
sequence W
description BINDING SITE FOR RESIDUE NAG N 476A
source : AC8

25) chain N
residue 83
type
ligand
sequence D
description BINDING SITE FOR RESIDUE NAG N 477A
source : AC9

26) chain N
residue 84
type
ligand
sequence F
description BINDING SITE FOR RESIDUE NAG N 477A
source : AC9

27) chain N
residue 86
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NAG N 477A
source : AC9

28) chain N
residue 294
type
ligand
sequence N
description BINDING SITE FOR RESIDUE CA N 478
source : CC1

29) chain N
residue 297
type
ligand
sequence G
description BINDING SITE FOR RESIDUE CA N 478
source : CC1

30) chain N
residue 347
type
ligand
sequence N
description BINDING SITE FOR RESIDUE CA N 478
source : CC1

31) chain N
residue 151
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1a4g
source CSA : CSA1

32) chain N
residue 277
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1a4g
source CSA : CSA1

33) chain N
residue 277
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1a4g
source CSA : CSA3

34) chain N
residue 151
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1a4g
source CSA : CSA3

35) chain N
residue 220
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1a4g
source CSA : CSA3

36) chain N
residue 412
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1a4g
source CSA : CSA3

37) chain N
residue 371
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1a4g
source CSA : CSA3


Display surface

Download
Links