eF-site ID 1nmc-B
PDB Code 1nmc
Chain B

click to enlarge
Title COMPLEX BETWEEN NC10 ANTI-INFLUENZA VIRUS NEURAMINIDASE SINGLE CHAIN ANTIBODY WITH A 15 RESIDUE LINKER AND INFLUENZA VIRUS NEURAMINIDASE
Classification COMPLEX (SINGLE-CHAIN ANTIBODY/ANTIGEN)
Compound NEURAMINIDASE
Source Influenza A virus (strain A/Tern/Australia/G70C/1975 H11N9) (AAA19165)
Sequence B:  QVQLQQSGAELVKPGASVRMSCKASGYTFTNYNMYWVKQS
PGQGLEWIGIFYPGNGDTSYNQKFKDKATLTADKSSNTAY
MQLSSLTSEDSAVYYCARSGGSYRYDGGFDYWGQGTTVTV
SS
Description (1)  NEURAMINIDASE, SINGLE CHAIN ANTIBODY


Functional site

1) chain B
residue 100
type
ligand
sequence R
description BINDING SITE FOR RESIDUE MAN A 474F
source : BC6


Display surface

Download
Links