eF-site ID 1nmc-ABC
PDB Code 1nmc
Chain A, B, C

click to enlarge
Title COMPLEX BETWEEN NC10 ANTI-INFLUENZA VIRUS NEURAMINIDASE SINGLE CHAIN ANTIBODY WITH A 15 RESIDUE LINKER AND INFLUENZA VIRUS NEURAMINIDASE
Classification COMPLEX (SINGLE-CHAIN ANTIBODY/ANTIGEN)
Compound NEURAMINIDASE
Source Influenza A virus (strain A/Tern/Australia/G70C/1975 H11N9) (AAA19165)
Sequence A:  RDFNNLTKGLCTINSWHIYGKDNAVRIGEDSDVLVTREPY
VSCDPDECRFYALSQGTTIRGKHSNGTIHDRSQYRALISW
PLSSPPTVYNSRVECIGWSSTSCHDGKTRMSICISGPNNN
ASAVIWYNRRPVTEINTWARNILRTQESECVCHNGVCPVV
FTDGSATGPAETRIYYFKEGKILKWEPLAGTAKHIEECSC
YGERAEITCTCRDNWQGSNRPVIRIDPVAMTHTSQYICSP
VLTDNPRPNDPTVGKCNDPYPGNNNNGVKGFSYLDGVNTW
LGRTISIASRSGYEMLKVPNALTDDKSKPTQGQTIVLNTD
WSGYSGSFMDYWAEGECYRACFYVELIRGRPKEDKVWWTS
NSIVSMCSSTEFLGQWDWPDGAKIEYFL
B:  QVQLQQSGAELVKPGASVRMSCKASGYTFTNYNMYWVKQS
PGQGLEWIGIFYPGNGDTSYNQKFKDKATLTADKSSNTAY
MQLSSLTSEDSAVYYCARSGGSYRYDGGFDYWGQGTTVTV
SS
C:  DIELTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQNP
DGTVKLLIYYTSNLHSEVPSRFSGSGSGTDYSLTISNLEQ
EDIATYFCQQDFTLPFTFGGGTKLEIRDY
Description (1)  NEURAMINIDASE, SINGLE CHAIN ANTIBODY


Functional site

1) chain A
residue 200
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NAG A 469A
source : BC1

2) chain A
residue 220
type
ligand
sequence R
description BINDING SITE FOR RESIDUE NAG A 469A
source : BC1

3) chain A
residue 453
type
ligand
sequence L
description BINDING SITE FOR RESIDUE NAG A 469A
source : BC1

4) chain A
residue 454
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NAG A 469A
source : BC1

5) chain A
residue 455
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE NAG A 469A
source : BC1

6) chain A
residue 392
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE NAG A 470B
source : BC2

7) chain A
residue 394
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NAG A 470B
source : BC2

8) chain A
residue 452
type
ligand
sequence F
description BINDING SITE FOR RESIDUE NAG A 470B
source : BC2

9) chain A
residue 377
type
ligand
sequence L
description BINDING SITE FOR RESIDUE BMA A 471C
source : BC3

10) chain A
residue 391
type
ligand
sequence T
description BINDING SITE FOR RESIDUE BMA A 471C
source : BC3

11) chain A
residue 394
type
ligand
sequence G
description BINDING SITE FOR RESIDUE BMA A 471C
source : BC3

12) chain A
residue 364
type
ligand
sequence R
description BINDING SITE FOR RESIDUE MAN A 472D
source : BC4

13) chain A
residue 375
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MAN A 472D
source : BC4

14) chain A
residue 330
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MAN A 473E
source : BC5

15) chain A
residue 389
type
ligand
sequence K
description BINDING SITE FOR RESIDUE MAN A 473E
source : BC5

16) chain A
residue 327
type
ligand
sequence R
description BINDING SITE FOR RESIDUE MAN A 474F
source : BC6

17) chain A
residue 329
type
ligand
sequence N
description BINDING SITE FOR RESIDUE MAN A 474F
source : BC6

18) chain A
residue 330
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MAN A 474F
source : BC6

19) chain A
residue 366
type
ligand
sequence I
description BINDING SITE FOR RESIDUE MAN A 474F
source : BC6

20) chain B
residue 100
type
ligand
sequence R
description BINDING SITE FOR RESIDUE MAN A 474F
source : BC6

21) chain A
residue 146
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NAG A 476A
source : BC8

22) chain A
residue 437
type
ligand
sequence W
description BINDING SITE FOR RESIDUE NAG A 476A
source : BC8

23) chain A
residue 83
type
ligand
sequence D
description BINDING SITE FOR RESIDUE NAG A 477A
source : BC9

24) chain A
residue 84
type
ligand
sequence F
description BINDING SITE FOR RESIDUE NAG A 477A
source : BC9

25) chain A
residue 86
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NAG A 477A
source : BC9

26) chain A
residue 294
type
ligand
sequence N
description BINDING SITE FOR RESIDUE CA A 478
source : CC2

27) chain A
residue 297
type
ligand
sequence G
description BINDING SITE FOR RESIDUE CA A 478
source : CC2

28) chain A
residue 347
type
ligand
sequence N
description BINDING SITE FOR RESIDUE CA A 478
source : CC2

29) chain A
residue 196
type ACT_SITE
ligand
sequence G
description Potential.
source Swiss-Prot : SWS_FT_FI6

30) chain A
residue 324
type ACT_SITE
ligand
sequence D
description Potential.
source Swiss-Prot : SWS_FT_FI6

31) chain A
residue 244
type METAL
ligand
sequence G
description Calcium (By similarity)
source Swiss-Prot : SWS_FT_FI7

32) chain A
residue 213
type METAL
ligand
sequence T
description Calcium; via carbonyl oxygen (By similarity)
source Swiss-Prot : SWS_FT_FI8

33) chain A
residue 217
type METAL
ligand
sequence T
description Calcium; via carbonyl oxygen (By similarity)
source Swiss-Prot : SWS_FT_FI8

34) chain A
residue 266
type METAL
ligand
sequence E
description Calcium; via carbonyl oxygen (By similarity)
source Swiss-Prot : SWS_FT_FI8

35) chain A
residue 212
type BINDING
ligand
sequence V
description Substrate (Potential).
source Swiss-Prot : SWS_FT_FI9

36) chain A
residue 290
type BINDING
ligand
sequence T
description Substrate (Potential).
source Swiss-Prot : SWS_FT_FI9

37) chain A
residue 83-86
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence DFNN
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1nmc_A_477

38) chain A
residue 234
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1nmc_A_477

39) chain A
residue 146
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1nmc_A_476

40) chain A
residue 437
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence W
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1nmc_A_476

41) chain A
residue 199-200
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence NN
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1nmc_A_469

42) chain A
residue 220
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence R
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1nmc_A_469

43) chain A
residue 151
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1a4g
source CSA : CSA2

44) chain A
residue 277
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1a4g
source CSA : CSA2

45) chain A
residue 277
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1a4g
source CSA : CSA4

46) chain A
residue 151
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1a4g
source CSA : CSA4

47) chain A
residue 220
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1a4g
source CSA : CSA4

48) chain A
residue 412
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1a4g
source CSA : CSA4

49) chain A
residue 371
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1a4g
source CSA : CSA4


Display surface

Download
Links