eF-site ID 1nmc-A
PDB Code 1nmc
Chain A

click to enlarge
Title COMPLEX BETWEEN NC10 ANTI-INFLUENZA VIRUS NEURAMINIDASE SINGLE CHAIN ANTIBODY WITH A 15 RESIDUE LINKER AND INFLUENZA VIRUS NEURAMINIDASE
Classification COMPLEX (SINGLE-CHAIN ANTIBODY/ANTIGEN)
Compound NEURAMINIDASE
Source (AAA19165)
Sequence A:  RDFNNLTKGLCTINSWHIYGKDNAVRIGEDSDVLVTREPY
VSCDPDECRFYALSQGTTIRGKHSNGTIHDRSQYRALISW
PLSSPPTVYNSRVECIGWSSTSCHDGKTRMSICISGPNNN
ASAVIWYNRRPVTEINTWARNILRTQESECVCHNGVCPVV
FTDGSATGPAETRIYYFKEGKILKWEPLAGTAKHIEECSC
YGERAEITCTCRDNWQGSNRPVIRIDPVAMTHTSQYICSP
VLTDNPRPNDPTVGKCNDPYPGNNNNGVKGFSYLDGVNTW
LGRTISIASRSGYEMLKVPNALTDDKSKPTQGQTIVLNTD
WSGYSGSFMDYWAEGECYRACFYVELIRGRPKEDKVWWTS
NSIVSMCSSTEFLGQWDWPDGAKIEYFL
Description (1)  NEURAMINIDASE, SINGLE CHAIN ANTIBODY


Functional site

1) chain A
residue 200
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NAG A 469A
source : BC1

2) chain A
residue 220
type
ligand
sequence R
description BINDING SITE FOR RESIDUE NAG A 469A
source : BC1

3) chain A
residue 453
type
ligand
sequence L
description BINDING SITE FOR RESIDUE NAG A 469A
source : BC1

4) chain A
residue 454
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NAG A 469A
source : BC1

5) chain A
residue 455
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE NAG A 469A
source : BC1

6) chain A
residue 392
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE NAG A 470B
source : BC2

7) chain A
residue 394
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NAG A 470B
source : BC2

8) chain A
residue 452
type
ligand
sequence F
description BINDING SITE FOR RESIDUE NAG A 470B
source : BC2

9) chain A
residue 377
type
ligand
sequence L
description BINDING SITE FOR RESIDUE BMA A 471C
source : BC3

10) chain A
residue 391
type
ligand
sequence T
description BINDING SITE FOR RESIDUE BMA A 471C
source : BC3

11) chain A
residue 394
type
ligand
sequence G
description BINDING SITE FOR RESIDUE BMA A 471C
source : BC3

12) chain A
residue 364
type
ligand
sequence R
description BINDING SITE FOR RESIDUE MAN A 472D
source : BC4

13) chain A
residue 375
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MAN A 472D
source : BC4

14) chain A
residue 330
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MAN A 473E
source : BC5

15) chain A
residue 389
type
ligand
sequence K
description BINDING SITE FOR RESIDUE MAN A 473E
source : BC5

16) chain A
residue 327
type
ligand
sequence R
description BINDING SITE FOR RESIDUE MAN A 474F
source : BC6

17) chain A
residue 329
type
ligand
sequence N
description BINDING SITE FOR RESIDUE MAN A 474F
source : BC6

18) chain A
residue 330
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MAN A 474F
source : BC6

19) chain A
residue 366
type
ligand
sequence I
description BINDING SITE FOR RESIDUE MAN A 474F
source : BC6

20) chain A
residue 146
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NAG A 476A
source : BC8

21) chain A
residue 437
type
ligand
sequence W
description BINDING SITE FOR RESIDUE NAG A 476A
source : BC8

22) chain A
residue 83
type
ligand
sequence D
description BINDING SITE FOR RESIDUE NAG A 477A
source : BC9

23) chain A
residue 84
type
ligand
sequence F
description BINDING SITE FOR RESIDUE NAG A 477A
source : BC9

24) chain A
residue 86
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NAG A 477A
source : BC9

25) chain A
residue 294
type
ligand
sequence N
description BINDING SITE FOR RESIDUE CA A 478
source : CC2

26) chain A
residue 297
type
ligand
sequence G
description BINDING SITE FOR RESIDUE CA A 478
source : CC2

27) chain A
residue 347
type
ligand
sequence N
description BINDING SITE FOR RESIDUE CA A 478
source : CC2

28) chain A
residue 151
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1a4g
source CSA : CSA2

29) chain A
residue 277
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1a4g
source CSA : CSA2

30) chain A
residue 277
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1a4g
source CSA : CSA4

31) chain A
residue 151
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1a4g
source CSA : CSA4

32) chain A
residue 220
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1a4g
source CSA : CSA4

33) chain A
residue 412
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1a4g
source CSA : CSA4

34) chain A
residue 371
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1a4g
source CSA : CSA4


Display surface

Download
Links