eF-site ID 1nmc-A PDB Code 1nmc Chain A click to enlarge Title COMPLEX BETWEEN NC10 ANTI-INFLUENZA VIRUS NEURAMINIDASE SINGLE CHAIN ANTIBODY WITH A 15 RESIDUE LINKER AND INFLUENZA VIRUS NEURAMINIDASE Classification COMPLEX (SINGLE-CHAIN ANTIBODY/ANTIGEN) Compound NEURAMINIDASE Source (AAA19165) Sequence A:  RDFNNLTKGLCTINSWHIYGKDNAVRIGEDSDVLVTREPY VSCDPDECRFYALSQGTTIRGKHSNGTIHDRSQYRALISW PLSSPPTVYNSRVECIGWSSTSCHDGKTRMSICISGPNNN ASAVIWYNRRPVTEINTWARNILRTQESECVCHNGVCPVV FTDGSATGPAETRIYYFKEGKILKWEPLAGTAKHIEECSC YGERAEITCTCRDNWQGSNRPVIRIDPVAMTHTSQYICSP VLTDNPRPNDPTVGKCNDPYPGNNNNGVKGFSYLDGVNTW LGRTISIASRSGYEMLKVPNALTDDKSKPTQGQTIVLNTD WSGYSGSFMDYWAEGECYRACFYVELIRGRPKEDKVWWTS NSIVSMCSSTEFLGQWDWPDGAKIEYFL Description Functional site 1) chain A residue 151 type catalytic sequence D description Annotated By Reference To The Literature 1a4g source CSA : CSA2 2) chain A residue 277 type catalytic sequence E description Annotated By Reference To The Literature 1a4g source CSA : CSA2 3) chain A residue 277 type catalytic sequence E description Annotated By Reference To The Literature 1a4g source CSA : CSA4 4) chain A residue 151 type catalytic sequence D description Annotated By Reference To The Literature 1a4g source CSA : CSA4 5) chain A residue 220 type catalytic sequence R description Annotated By Reference To The Literature 1a4g source CSA : CSA4 6) chain A residue 412 type catalytic sequence D description Annotated By Reference To The Literature 1a4g source CSA : CSA4 7) chain A residue 371 type catalytic sequence R description Annotated By Reference To The Literature 1a4g source CSA : CSA4 8) chain A residue 151 type catalytic sequence D description 828 source MCSA : MCSA1 9) chain A residue 277 type catalytic sequence E description 828 source MCSA : MCSA1 10) chain A residue 292 type catalytic sequence R description 828 source MCSA : MCSA1 11) chain A residue 371 type catalytic sequence R description 828 source MCSA : MCSA1 12) chain A residue 406 type catalytic sequence Y description 828 source MCSA : MCSA1

Display surface Download Links