eF-site ID 1nmc-A PDB Code 1nmc Chain A click to enlarge Title COMPLEX BETWEEN NC10 ANTI-INFLUENZA VIRUS NEURAMINIDASE SINGLE CHAIN ANTIBODY WITH A 15 RESIDUE LINKER AND INFLUENZA VIRUS NEURAMINIDASE Classification COMPLEX (SINGLE-CHAIN ANTIBODY/ANTIGEN) Compound NEURAMINIDASE Source Influenza A virus (strain A/Tern/Australia/G70C/1975 H11N9) (AAA19165) Sequence A:  RDFNNLTKGLCTINSWHIYGKDNAVRIGEDSDVLVTREPY VSCDPDECRFYALSQGTTIRGKHSNGTIHDRSQYRALISW PLSSPPTVYNSRVECIGWSSTSCHDGKTRMSICISGPNNN ASAVIWYNRRPVTEINTWARNILRTQESECVCHNGVCPVV FTDGSATGPAETRIYYFKEGKILKWEPLAGTAKHIEECSC YGERAEITCTCRDNWQGSNRPVIRIDPVAMTHTSQYICSP VLTDNPRPNDPTVGKCNDPYPGNNNNGVKGFSYLDGVNTW LGRTISIASRSGYEMLKVPNALTDDKSKPTQGQTIVLNTD WSGYSGSFMDYWAEGECYRACFYVELIRGRPKEDKVWWTS NSIVSMCSSTEFLGQWDWPDGAKIEYFL Description (1)  NEURAMINIDASE, SINGLE CHAIN ANTIBODY Functional site 1) chain A residue 200 type ligand sequence N description BINDING SITE FOR RESIDUE NAG A 469A source : BC1 2) chain A residue 220 type ligand sequence R description BINDING SITE FOR RESIDUE NAG A 469A source : BC1 3) chain A residue 453 type ligand sequence L description BINDING SITE FOR RESIDUE NAG A 469A source : BC1 4) chain A residue 454 type ligand sequence G description BINDING SITE FOR RESIDUE NAG A 469A source : BC1 5) chain A residue 455 type ligand sequence Q description BINDING SITE FOR RESIDUE NAG A 469A source : BC1 6) chain A residue 392 type ligand sequence Q description BINDING SITE FOR RESIDUE NAG A 470B source : BC2 7) chain A residue 394 type ligand sequence G description BINDING SITE FOR RESIDUE NAG A 470B source : BC2 8) chain A residue 452 type ligand sequence F description BINDING SITE FOR RESIDUE NAG A 470B source : BC2 9) chain A residue 377 type ligand sequence L description BINDING SITE FOR RESIDUE BMA A 471C source : BC3 10) chain A residue 391 type ligand sequence T description BINDING SITE FOR RESIDUE BMA A 471C source : BC3 11) chain A residue 394 type ligand sequence G description BINDING SITE FOR RESIDUE BMA A 471C source : BC3 12) chain A residue 364 type ligand sequence R description BINDING SITE FOR RESIDUE MAN A 472D source : BC4 13) chain A residue 375 type ligand sequence E description BINDING SITE FOR RESIDUE MAN A 472D source : BC4 14) chain A residue 330 type ligand sequence D description BINDING SITE FOR RESIDUE MAN A 473E source : BC5 15) chain A residue 389 type ligand sequence K description BINDING SITE FOR RESIDUE MAN A 473E source : BC5 16) chain A residue 327 type ligand sequence R description BINDING SITE FOR RESIDUE MAN A 474F source : BC6 17) chain A residue 329 type ligand sequence N description BINDING SITE FOR RESIDUE MAN A 474F source : BC6 18) chain A residue 330 type ligand sequence D description BINDING SITE FOR RESIDUE MAN A 474F source : BC6 19) chain A residue 366 type ligand sequence I description BINDING SITE FOR RESIDUE MAN A 474F source : BC6 20) chain A residue 146 type ligand sequence N description BINDING SITE FOR RESIDUE NAG A 476A source : BC8 21) chain A residue 437 type ligand sequence W description BINDING SITE FOR RESIDUE NAG A 476A source : BC8 22) chain A residue 83 type ligand sequence D description BINDING SITE FOR RESIDUE NAG A 477A source : BC9 23) chain A residue 84 type ligand sequence F description BINDING SITE FOR RESIDUE NAG A 477A source : BC9 24) chain A residue 86 type ligand sequence N description BINDING SITE FOR RESIDUE NAG A 477A source : BC9 25) chain A residue 294 type ligand sequence N description BINDING SITE FOR RESIDUE CA A 478 source : CC2 26) chain A residue 297 type ligand sequence G description BINDING SITE FOR RESIDUE CA A 478 source : CC2 27) chain A residue 347 type ligand sequence N description BINDING SITE FOR RESIDUE CA A 478 source : CC2 28) chain A residue 196 type ACT_SITE ligand sequence G description Potential. source Swiss-Prot : SWS_FT_FI6 29) chain A residue 324 type ACT_SITE ligand sequence D description Potential. source Swiss-Prot : SWS_FT_FI6 30) chain A residue 244 type METAL ligand sequence G description Calcium (By similarity) source Swiss-Prot : SWS_FT_FI7 31) chain A residue 213 type METAL ligand sequence T description Calcium; via carbonyl oxygen (By similarity) source Swiss-Prot : SWS_FT_FI8 32) chain A residue 217 type METAL ligand sequence T description Calcium; via carbonyl oxygen (By similarity) source Swiss-Prot : SWS_FT_FI8 33) chain A residue 266 type METAL ligand sequence E description Calcium; via carbonyl oxygen (By similarity) source Swiss-Prot : SWS_FT_FI8 34) chain A residue 212 type BINDING ligand sequence V description Substrate (Potential). source Swiss-Prot : SWS_FT_FI9 35) chain A residue 290 type BINDING ligand sequence T description Substrate (Potential). source Swiss-Prot : SWS_FT_FI9 36) chain A residue 83-86 type binding ligand NAG: N-ACETYL-D-GLUCOSAMINE sequence DFNN description N-ACETYL-D-GLUCOSAMINE binding site source pdb_hetatom : NAG_1nmc_A_477 37) chain A residue 234 type binding ligand NAG: N-ACETYL-D-GLUCOSAMINE sequence N description N-ACETYL-D-GLUCOSAMINE binding site source pdb_hetatom : NAG_1nmc_A_477 38) chain A residue 146 type binding ligand NAG: N-ACETYL-D-GLUCOSAMINE sequence N description N-ACETYL-D-GLUCOSAMINE binding site source pdb_hetatom : NAG_1nmc_A_476 39) chain A residue 437 type binding ligand NAG: N-ACETYL-D-GLUCOSAMINE sequence W description N-ACETYL-D-GLUCOSAMINE binding site source pdb_hetatom : NAG_1nmc_A_476 40) chain A residue 199-200 type binding ligand NAG: N-ACETYL-D-GLUCOSAMINE sequence NN description N-ACETYL-D-GLUCOSAMINE binding site source pdb_hetatom : NAG_1nmc_A_469 41) chain A residue 220 type binding ligand NAG: N-ACETYL-D-GLUCOSAMINE sequence R description N-ACETYL-D-GLUCOSAMINE binding site source pdb_hetatom : NAG_1nmc_A_469 42) chain A residue 151 type catalytic ligand sequence D description Annotated By Reference To The Literature 1a4g source CSA : CSA2 43) chain A residue 277 type catalytic ligand sequence E description Annotated By Reference To The Literature 1a4g source CSA : CSA2 44) chain A residue 277 type catalytic ligand sequence E description Annotated By Reference To The Literature 1a4g source CSA : CSA4 45) chain A residue 151 type catalytic ligand sequence D description Annotated By Reference To The Literature 1a4g source CSA : CSA4 46) chain A residue 220 type catalytic ligand sequence R description Annotated By Reference To The Literature 1a4g source CSA : CSA4 47) chain A residue 412 type catalytic ligand sequence D description Annotated By Reference To The Literature 1a4g source CSA : CSA4 48) chain A residue 371 type catalytic ligand sequence R description Annotated By Reference To The Literature 1a4g source CSA : CSA4

Display surface Download Links