eF-site ID 1nmc-N PDB Code 1nmc Chain N click to enlarge Title COMPLEX BETWEEN NC10 ANTI-INFLUENZA VIRUS NEURAMINIDASE SINGLE CHAIN ANTIBODY WITH A 15 RESIDUE LINKER AND INFLUENZA VIRUS NEURAMINIDASE Classification COMPLEX (SINGLE-CHAIN ANTIBODY/ANTIGEN) Compound NEURAMINIDASE Source (AAA19165) Sequence N:  RDFNNLTKGLCTINSWHIYGKDNAVRIGEDSDVLVTREPY VSCDPDECRFYALSQGTTIRGKHSNGTIHDRSQYRALISW PLSSPPTVYNSRVECIGWSSTSCHDGKTRMSICISGPNNN ASAVIWYNRRPVTEINTWARNILRTQESECVCHNGVCPVV FTDGSATGPAETRIYYFKEGKILKWEPLAGTAKHIEECSC YGERAEITCTCRDNWQGSNRPVIRIDPVAMTHTSQYICSP VLTDNPRPNDPTVGKCNDPYPGNNNNGVKGFSYLDGVNTW LGRTISIASRSGYEMLKVPNALTDDKSKPTQGQTIVLNTD WSGYSGSFMDYWAEGECYRACFYVELIRGRPKEDKVWWTS NSIVSMCSSTEFLGQWDWPDGAKIEYFL Description Functional site 1) chain N residue 151 type ACT_SITE sequence D description Proton donor/acceptor => ECO:0000255|HAMAP-Rule:MF_04071 source Swiss-Prot : SWS_FT_FI1 2) chain N residue 406 type ACT_SITE sequence Y description Nucleophile => ECO:0000255|HAMAP-Rule:MF_04071 source Swiss-Prot : SWS_FT_FI2 3) chain N residue 118 type BINDING sequence R description BINDING => ECO:0000255|HAMAP-Rule:MF_04071 source Swiss-Prot : SWS_FT_FI3 4) chain N residue 152 type BINDING sequence R description BINDING => ECO:0000255|HAMAP-Rule:MF_04071 source Swiss-Prot : SWS_FT_FI3 5) chain N residue 276 type BINDING sequence E description BINDING => ECO:0000255|HAMAP-Rule:MF_04071 source Swiss-Prot : SWS_FT_FI3 6) chain N residue 292 type BINDING sequence R description BINDING => ECO:0000255|HAMAP-Rule:MF_04071 source Swiss-Prot : SWS_FT_FI3 7) chain N residue 371 type BINDING sequence R description BINDING => ECO:0000255|HAMAP-Rule:MF_04071 source Swiss-Prot : SWS_FT_FI3 8) chain N residue 324 type BINDING sequence D description BINDING => ECO:0000255|HAMAP-Rule:MF_04071, ECO:0000269|PubMed:23429702, ECO:0000269|PubMed:7549872, ECO:0000269|PubMed:8371267, ECO:0000269|PubMed:9342319 source Swiss-Prot : SWS_FT_FI4 9) chain N residue 347 type BINDING sequence N description BINDING => ECO:0000255|HAMAP-Rule:MF_04071, ECO:0000269|PubMed:23429702, ECO:0000269|PubMed:7549872, ECO:0000269|PubMed:8371267, ECO:0000269|PubMed:9342319 source Swiss-Prot : SWS_FT_FI4 10) chain N residue 293 type BINDING sequence D description BINDING => ECO:0000255|HAMAP-Rule:MF_04071, ECO:0000269|PubMed:23429702, ECO:0000269|PubMed:7549872, ECO:0000269|PubMed:8371267, ECO:0000269|PubMed:9342319 source Swiss-Prot : SWS_FT_FI4 11) chain N residue 297 type BINDING sequence G description BINDING => ECO:0000255|HAMAP-Rule:MF_04071, ECO:0000269|PubMed:23429702, ECO:0000269|PubMed:7549872, ECO:0000269|PubMed:8371267, ECO:0000269|PubMed:9342319 source Swiss-Prot : SWS_FT_FI4 12) chain N residue 86 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine; by host => ECO:0000255|HAMAP-Rule:MF_04071, ECO:0000269|PubMed:23429702, ECO:0000269|PubMed:7549872, ECO:0000269|PubMed:9342319 source Swiss-Prot : SWS_FT_FI5 13) chain N residue 146 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine; by host => ECO:0000255|HAMAP-Rule:MF_04071, ECO:0000269|PubMed:23429702, ECO:0000269|PubMed:7549872, ECO:0000269|PubMed:9342319 source Swiss-Prot : SWS_FT_FI5 14) chain N residue 200 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine; by host => ECO:0000255|HAMAP-Rule:MF_04071, ECO:0000269|PubMed:23429702, ECO:0000269|PubMed:7549872, ECO:0000269|PubMed:9342319 source Swiss-Prot : SWS_FT_FI5 15) chain N residue 151 type catalytic sequence D description 828 source MCSA : MCSA1 16) chain N residue 277 type catalytic sequence E description 828 source MCSA : MCSA1 17) chain N residue 292 type catalytic sequence R description 828 source MCSA : MCSA1 18) chain N residue 371 type catalytic sequence R description 828 source MCSA : MCSA1 19) chain N residue 406 type catalytic sequence Y description 828 source MCSA : MCSA1

Display surface Download Links