eF-site ID 1nj2-A
PDB Code 1nj2
Chain A

click to enlarge
Title Crystal structure of Prolyl-tRNA Synthetase from Methanothermobacter thermautotrophicus
Classification LIGASE
Compound Proline-tRNA Synthetase
Source Methanobacterium thermoautotrophicum (strain Delta H) (SYP_METTH)
Sequence A:  EFSEWFHNILEEAEIIDQRYPVKGMHVWMPHGFMIRKNTL
KILRRILDRDHEEVLFPLLVPEDELAEVYWVTHGGLSKLQ
RKLALRPTSETVMYPMFALWVRSHTDLPMRFYQVVNTFRY
ETKHTRPLIRVREITTFKEAHTIHATASEAEEQVERAVEI
YKEFFNSLGIPYLITRRPPWDKFPGSEYTVAFDTLMPDGK
TLQIGTVHNLGQTFARTFEIKFETPEGDHEYVHQTCYGLS
DRVIASVIAIHGDESGLCLPPDVAAHQVVIVPIIFKKAAE
EVMEACRELRSRLEAAGFRVHLDDRDIRAGRKYYEWEMRG
VPLRVEIGPRDLEKGAAVISRRDTGEKVTADLQGIEETLR
ELMKDILENLRTRAWERMESEIREAETLEEASRIVDEKRG
IISFMWCGEEECGMDVEEKVRVDILGIQEEGSGTCINCGR
EAPYRAYLARTY
Description (1)  Proline-tRNA Synthetase (E.C.6.1.1.15)


Functional site

1) chain A
residue 436
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 495
source : AC1

2) chain A
residue 441
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 495
source : AC1

3) chain A
residue 464
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 495
source : AC1

4) chain A
residue 467
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 495
source : AC1

5) chain A
residue 452
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MG A 496
source : AC2

6) chain A
residue 456
type METAL
ligand
sequence I
description Zinc; structural
source Swiss-Prot : SWS_FT_FI1

7) chain A
residue 461
type METAL
ligand
sequence S
description Zinc; structural
source Swiss-Prot : SWS_FT_FI1

8) chain A
residue 168
type BINDING
ligand
sequence E
description ATP.
source Swiss-Prot : SWS_FT_FI2

9) chain A
residue 170
type BINDING
ligand
sequence H
description ATP.
source Swiss-Prot : SWS_FT_FI2

10) chain A
residue 252
type BINDING
ligand
sequence E
description ATP.
source Swiss-Prot : SWS_FT_FI2

11) chain A
residue 255
type BINDING
ligand
sequence E
description ATP.
source Swiss-Prot : SWS_FT_FI2

12) chain A
residue 289
type BINDING
ligand
sequence P
description ATP.
source Swiss-Prot : SWS_FT_FI2

13) chain A
residue 137
type BINDING
ligand
sequence P
description Proline.
source Swiss-Prot : SWS_FT_FI3

14) chain A
residue 139
type BINDING
ligand
sequence R
description Proline.
source Swiss-Prot : SWS_FT_FI3

15) chain A
residue 168
type BINDING
ligand
sequence E
description Proline.
source Swiss-Prot : SWS_FT_FI3

16) chain A
residue 257
type BINDING
ligand
sequence D
description Proline.
source Swiss-Prot : SWS_FT_FI3

17) chain A
residue 148
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1qf6
source CSA : CSA1


Display surface

Download
Links