eF-site ID 1nik-J
PDB Code 1nik
Chain J

click to enlarge
Title Wild Type RNA Polymerase II
Classification TRANSCRIPTION
Compound RPB1
Source ORGANISM_COMMON: baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae;
Sequence J:  MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLG
LKRYCCRRMILTHVDLIEKFLRYNP
Description (1)  RPB1, RPB2, RPB3, RPB4, RPB5, RPB6, RPB7, RPB8, RPB9, RPB10, RPB11, RPB12 (E.C.2.7.7.6)


Functional site

1) chain J
residue 7
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN J 101
source : AC7

2) chain J
residue 10
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN J 101
source : AC7

3) chain J
residue 45
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN J 101
source : AC7

4) chain J
residue 46
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN J 101
source : AC7

5) chain J
residue 7
type METAL
ligand
sequence C
description Zinc
source Swiss-Prot : SWS_FT_FI11

6) chain J
residue 10
type METAL
ligand
sequence C
description Zinc
source Swiss-Prot : SWS_FT_FI11

7) chain J
residue 44
type METAL
ligand
sequence Y
description Zinc
source Swiss-Prot : SWS_FT_FI11

8) chain J
residue 45
type METAL
ligand
sequence C
description Zinc
source Swiss-Prot : SWS_FT_FI11


Display surface

Download
Links