eF-site ID 1nib-A PDB Code 1nib Chain A click to enlarge Title THE STRUCTURE OF CU-NITRITE REDUCTASE FROM ACHROMOBACTER CYCLOCLASTES AT FIVE PH VALUES, WITH NITRITE BOUND AND WITH TYPE II CU DEPLETED Classification OXIDOREDUCTASE (NITRIC OXIDE(A)) Compound NITRITE REDUCTASE Source ORGANISM_SCIENTIFIC: Achromobacter cycloclastes; Sequence A:  DISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEE KKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLIN PDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKAT KPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKG QPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAV KAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQ ANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGT AGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWN DDLMTSVVKPASM Description Functional site 1) chain A residue 95 type sequence H description TYPE I CU (A 501) BINDING SITE IN CHAIN A source : AC1 2) chain A residue 136 type sequence C description TYPE I CU (A 501) BINDING SITE IN CHAIN A source : AC1 3) chain A residue 145 type sequence H description TYPE I CU (A 501) BINDING SITE IN CHAIN A source : AC1 4) chain A residue 150 type sequence M description TYPE I CU (A 501) BINDING SITE IN CHAIN A source : AC1 5) chain A residue 100 type sequence H description TYPE II CU (A 502) BINDING SITE IN CHAIN A source : AC2 6) chain A residue 135 type sequence H description TYPE II CU (A 502) BINDING SITE IN CHAIN A source : AC2 7) chain A residue 95 type sequence H description BINDING SITE FOR RESIDUE CU A 501 source : AC3 8) chain A residue 136 type sequence C description BINDING SITE FOR RESIDUE CU A 501 source : AC3 9) chain A residue 145 type sequence H description BINDING SITE FOR RESIDUE CU A 501 source : AC3 10) chain A residue 150 type sequence M description BINDING SITE FOR RESIDUE CU A 501 source : AC3 11) chain A residue 100 type sequence H description BINDING SITE FOR RESIDUE CU A 502 source : AC4 12) chain A residue 135 type sequence H description BINDING SITE FOR RESIDUE CU A 502 source : AC4 13) chain A residue 255 type sequence H description BINDING SITE FOR RESIDUE CU C 502 source : AC8 14) chain A residue 306 type sequence H description BINDING SITE FOR RESIDUE CU C 502 source : AC8 15) chain A residue 95 type catalytic sequence H description 4 source MCSA : MCSA1 16) chain A residue 280 type catalytic sequence T description 4 source MCSA : MCSA1 17) chain A residue 306 type catalytic sequence H description 4 source MCSA : MCSA1 18) chain A residue 98 type catalytic sequence D description 4 source MCSA : MCSA1 19) chain A residue 100 type catalytic sequence H description 4 source MCSA : MCSA1 20) chain A residue 135 type catalytic sequence H description 4 source MCSA : MCSA1 21) chain A residue 136 type catalytic sequence C description 4 source MCSA : MCSA1 22) chain A residue 145 type catalytic sequence H description 4 source MCSA : MCSA1 23) chain A residue 150 type catalytic sequence M description 4 source MCSA : MCSA1 24) chain A residue 255 type catalytic sequence H description 4 source MCSA : MCSA1 25) chain A residue 279 type catalytic sequence E description 4 source MCSA : MCSA1 26) chain A residue 95 type BINDING sequence H description type 1 copper site source Swiss-Prot : SWS_FT_FI1 27) chain A residue 136 type BINDING sequence C description type 1 copper site source Swiss-Prot : SWS_FT_FI1 28) chain A residue 145 type BINDING sequence H description type 1 copper site source Swiss-Prot : SWS_FT_FI1 29) chain A residue 150 type BINDING sequence M description type 1 copper site source Swiss-Prot : SWS_FT_FI1 30) chain A residue 100 type BINDING sequence H description type 2 copper site source Swiss-Prot : SWS_FT_FI2 31) chain A residue 135 type BINDING sequence H description type 2 copper site source Swiss-Prot : SWS_FT_FI2 32) chain A residue 306 type BINDING sequence H description type 2 copper site source Swiss-Prot : SWS_FT_FI2

Display surface Download Links