eF-site ID 1nf6-L PDB Code 1nf6 Chain L click to enlarge Title X-ray structure of the Desulfovibrio desulfuricans bacterioferritin: the diiron site in different catalytic states ("cycled" structure: reduced in solution and allowed to reoxidise before crystallisation) Classification IRON STORAGE/ELECTRON TRANSPORT Compound bacterioferritin Source ORGANISM_SCIENTIFIC: Desulfovibrio desulfuricans; Sequence L:  GNREDRKAKVIEVLNKARAMELHAIHQYMNQHYSLDDMDY GELAANMKLIAIDEMRHAENFAERIKELGGEPTTQKEGKV VTGQAVPVIYESDADQEDATIEAYSQFLKVCKEQGDIVTA RLFERIIEEEQAHLTYYENIGSHIKNLGDTYLAKIAGTPS STGTASKGFV Description Functional site 1) chain L residue 4 type sequence N description BINDING SITE FOR RESIDUE SO4 I 1902 source : DC2 2) chain L residue 5 type sequence R description BINDING SITE FOR RESIDUE SO4 I 1902 source : DC2 3) chain L residue 56 type sequence E description BINDING SITE FOR RESIDUE FE L 200 source : EC1 4) chain L residue 99 type sequence E description BINDING SITE FOR RESIDUE FE L 200 source : EC1 5) chain L residue 132 type sequence E description BINDING SITE FOR RESIDUE FE L 200 source : EC1 6) chain L residue 135 type sequence H description BINDING SITE FOR RESIDUE FE L 200 source : EC1 7) chain L residue 50 type sequence K description BINDING SITE FOR RESIDUE SO4 L 2201 source : EC2 8) chain L residue 162 type sequence S description BINDING SITE FOR RESIDUE SO4 L 2201 source : EC2 9) chain L residue 164 type sequence T description BINDING SITE FOR RESIDUE SO4 L 2201 source : EC2 10) chain L residue 165 type sequence G description BINDING SITE FOR RESIDUE SO4 L 2201 source : EC2 11) chain L residue 114 type sequence K description BINDING SITE FOR RESIDUE SO4 L 2204 source : EC3 12) chain L residue 114 type sequence K description BINDING SITE FOR RESIDUE SO4 L 2204 source : EC3 13) chain L residue 114 type sequence K description BINDING SITE FOR RESIDUE SO4 L 2204 source : EC3 14) chain L residue 90 type sequence V description BINDING SITE FOR RESIDUE SO4 M 2303 source : EC7 15) chain L residue 20 type sequence R description BINDING SITE FOR RESIDUE FEC K 2104 source : GC2 16) chain L residue 31 type sequence M description BINDING SITE FOR RESIDUE FEC K 2104 source : GC2 17) chain L residue 35 type sequence Y description BINDING SITE FOR RESIDUE FEC K 2104 source : GC2 18) chain L residue 50 type sequence K description BINDING SITE FOR RESIDUE FEC K 2104 source : GC2 19) chain L residue 57 type sequence M description BINDING SITE FOR RESIDUE FEC K 2104 source : GC2 20) chain L residue 61 type sequence E description BINDING SITE FOR RESIDUE FEC K 2104 source : GC2 21) chain L residue 168 type sequence S description BINDING SITE FOR RESIDUE FEC K 2104 source : GC2 22) chain L residue 169 type sequence K description BINDING SITE FOR RESIDUE FEC K 2104 source : GC2 23) chain L residue 23 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 24) chain L residue 56 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 25) chain L residue 59 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 26) chain L residue 99 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 27) chain L residue 132 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 28) chain L residue 135 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 29) chain L residue 57 type BINDING sequence M description axial binding residue source Swiss-Prot : SWS_FT_FI2

Display surface Download Links