eF-site ID 1nf6-M PDB Code 1nf6 Chain M click to enlarge Title X-ray structure of the Desulfovibrio desulfuricans bacterioferritin: the diiron site in different catalytic states ("cycled" structure: reduced in solution and allowed to reoxidise before crystallisation) Classification IRON STORAGE/ELECTRON TRANSPORT Compound bacterioferritin Source ORGANISM_SCIENTIFIC: Desulfovibrio desulfuricans; Sequence M:  NREDRKAKVIEVLNKARAMELHAIHQYMNQHYSLDDMDYG ELAANMKLIAIDEMRHAENFAERIKELGGEPTTQKEGKVV TGQAVPVIYESDADQEDATIEAYSQFLKVCKEQGDIVTAR LFERIIEEEQAHLTYYENIGSHIKNLGDTYLAKIAGTPSS TGTASKGFV Description Functional site 1) chain M residue 114 type sequence K description BINDING SITE FOR RESIDUE SO4 I 1804 source : CC8 2) chain M residue 56 type sequence E description BINDING SITE FOR RESIDUE FE M 200 source : EC4 3) chain M residue 99 type sequence E description BINDING SITE FOR RESIDUE FE M 200 source : EC4 4) chain M residue 132 type sequence E description BINDING SITE FOR RESIDUE FE M 200 source : EC4 5) chain M residue 135 type sequence H description BINDING SITE FOR RESIDUE FE M 200 source : EC4 6) chain M residue 50 type sequence K description BINDING SITE FOR RESIDUE SO4 M 2301 source : EC5 7) chain M residue 163 type sequence S description BINDING SITE FOR RESIDUE SO4 M 2301 source : EC5 8) chain M residue 164 type sequence T description BINDING SITE FOR RESIDUE SO4 M 2301 source : EC5 9) chain M residue 4 type sequence N description BINDING SITE FOR RESIDUE SO4 M 2302 source : EC6 10) chain M residue 5 type sequence R description BINDING SITE FOR RESIDUE SO4 M 2302 source : EC6 11) chain M residue 144 type sequence S description BINDING SITE FOR RESIDUE SO4 M 2303 source : EC7 12) chain M residue 147 type sequence K description BINDING SITE FOR RESIDUE SO4 M 2303 source : EC7 13) chain M residue 148 type sequence N description BINDING SITE FOR RESIDUE SO4 M 2303 source : EC7 14) chain M residue 20 type sequence R description BINDING SITE FOR RESIDUE FEC N 2403 source : GC3 15) chain M residue 27 type sequence I description BINDING SITE FOR RESIDUE FEC N 2403 source : GC3 16) chain M residue 28 type sequence H description BINDING SITE FOR RESIDUE FEC N 2403 source : GC3 17) chain M residue 31 type sequence M description BINDING SITE FOR RESIDUE FEC N 2403 source : GC3 18) chain M residue 35 type sequence Y description BINDING SITE FOR RESIDUE FEC N 2403 source : GC3 19) chain M residue 50 type sequence K description BINDING SITE FOR RESIDUE FEC N 2403 source : GC3 20) chain M residue 54 type sequence I description BINDING SITE FOR RESIDUE FEC N 2403 source : GC3 21) chain M residue 57 type sequence M description BINDING SITE FOR RESIDUE FEC N 2403 source : GC3 22) chain M residue 61 type sequence E description BINDING SITE FOR RESIDUE FEC N 2403 source : GC3 23) chain M residue 168 type sequence S description BINDING SITE FOR RESIDUE FEC N 2403 source : GC3 24) chain M residue 23 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 25) chain M residue 56 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 26) chain M residue 59 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 27) chain M residue 99 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 28) chain M residue 132 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 29) chain M residue 135 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 30) chain M residue 57 type BINDING sequence M description axial binding residue source Swiss-Prot : SWS_FT_FI2

Display surface Download Links