eF-site ID 1nf6-A PDB Code 1nf6 Chain A click to enlarge Title X-ray structure of the Desulfovibrio desulfuricans bacterioferritin: the diiron site in different catalytic states ("cycled" structure: reduced in solution and allowed to reoxidise before crystallisation) Classification IRON STORAGE/ELECTRON TRANSPORT Compound bacterioferritin Source ORGANISM_SCIENTIFIC: Desulfovibrio desulfuricans; Sequence A:  GNREDRKAKVIEVLNKARAMELHAIHQYMNQHYSLDDMDY GELAANMKLIAIDEMRHAENFAERIKELGGEPTTQKEGKV VTGQAVPVIYESDADQEDATIEAYSQFLKVCKEQGDIVTA RLFERIIEEEQAHLTYYENIGSHIKNLGDTYLAKIAGTPS STGTASKGFV Description Functional site 1) chain A residue 56 type sequence E description BINDING SITE FOR RESIDUE FE A 200 source : AC1 2) chain A residue 99 type sequence E description BINDING SITE FOR RESIDUE FE A 200 source : AC1 3) chain A residue 132 type sequence E description BINDING SITE FOR RESIDUE FE A 200 source : AC1 4) chain A residue 135 type sequence H description BINDING SITE FOR RESIDUE FE A 200 source : AC1 5) chain A residue 50 type sequence K description BINDING SITE FOR RESIDUE SO4 A 1001 source : AC2 6) chain A residue 162 type sequence S description BINDING SITE FOR RESIDUE SO4 A 1001 source : AC2 7) chain A residue 164 type sequence T description BINDING SITE FOR RESIDUE SO4 A 1001 source : AC2 8) chain A residue 165 type sequence G description BINDING SITE FOR RESIDUE SO4 A 1001 source : AC2 9) chain A residue 144 type sequence S description BINDING SITE FOR RESIDUE SO4 A 1003 source : AC3 10) chain A residue 148 type sequence N description BINDING SITE FOR RESIDUE SO4 A 1003 source : AC3 11) chain A residue 114 type sequence K description BINDING SITE FOR RESIDUE SO4 A 1004 source : AC4 12) chain A residue 114 type sequence K description BINDING SITE FOR RESIDUE SO4 A 1004 source : AC4 13) chain A residue 114 type sequence K description BINDING SITE FOR RESIDUE SO4 A 1004 source : AC4 14) chain A residue 20 type sequence R description BINDING SITE FOR RESIDUE FEC A 1005 source : FC6 15) chain A residue 31 type sequence M description BINDING SITE FOR RESIDUE FEC A 1005 source : FC6 16) chain A residue 35 type sequence Y description BINDING SITE FOR RESIDUE FEC A 1005 source : FC6 17) chain A residue 50 type sequence K description BINDING SITE FOR RESIDUE FEC A 1005 source : FC6 18) chain A residue 57 type sequence M description BINDING SITE FOR RESIDUE FEC A 1005 source : FC6 19) chain A residue 61 type sequence E description BINDING SITE FOR RESIDUE FEC A 1005 source : FC6 20) chain A residue 168 type sequence S description BINDING SITE FOR RESIDUE FEC A 1005 source : FC6 21) chain A residue 169 type sequence K description BINDING SITE FOR RESIDUE FEC A 1005 source : FC6 22) chain A residue 23 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 23) chain A residue 56 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 24) chain A residue 59 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 25) chain A residue 99 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 26) chain A residue 132 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 27) chain A residue 135 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 28) chain A residue 57 type BINDING sequence M description axial binding residue source Swiss-Prot : SWS_FT_FI2

Display surface Download Links