eF-site ID 1nf4-O PDB Code 1nf4 Chain O click to enlarge Title X-Ray Structure of the Desulfovibrio desulfuricans bacterioferritin: the diiron site in different states (reduced structure) Classification IRON STORAGE/ELECTRON TRANSPORT Compound bacterioferritin Source ORGANISM_SCIENTIFIC: Desulfovibrio desulfuricans; Sequence O:  NREDRKAKVIEVLNKARAMELHAIHQYMNQHYSLDDMDYG ELAANMKLIAIDEMRHAENFAERIKELGGEPTTQKEGKVV TGQAVPVIYESDADQEDATIEAYSQFLKVCKEQGDIVTAR LFERIIEEEQAHLTYYENIGSHIKNLGDTYLAKIAGTPSS TGTASKGFV Description Functional site 1) chain O residue 114 type sequence K description BINDING SITE FOR RESIDUE SO4 E 1304 source : CC5 2) chain O residue 23 type sequence E description BINDING SITE FOR RESIDUE FE2 O 200 source : IC8 3) chain O residue 56 type sequence E description BINDING SITE FOR RESIDUE FE2 O 200 source : IC8 4) chain O residue 59 type sequence H description BINDING SITE FOR RESIDUE FE2 O 200 source : IC8 5) chain O residue 132 type sequence E description BINDING SITE FOR RESIDUE FE2 O 200 source : IC8 6) chain O residue 56 type sequence E description BINDING SITE FOR RESIDUE FE2 O 201 source : IC9 7) chain O residue 99 type sequence E description BINDING SITE FOR RESIDUE FE2 O 201 source : IC9 8) chain O residue 132 type sequence E description BINDING SITE FOR RESIDUE FE2 O 201 source : IC9 9) chain O residue 135 type sequence H description BINDING SITE FOR RESIDUE FE2 O 201 source : IC9 10) chain O residue 144 type sequence S description BINDING SITE FOR RESIDUE SO4 O 2403 source : JC1 11) chain O residue 148 type sequence N description BINDING SITE FOR RESIDUE SO4 O 2403 source : JC1 12) chain O residue 161 type sequence P description BINDING SITE FOR RESIDUE SO4 O 2406 source : JC2 13) chain O residue 162 type sequence S description BINDING SITE FOR RESIDUE SO4 O 2406 source : JC2 14) chain O residue 163 type sequence S description BINDING SITE FOR RESIDUE SO4 O 2406 source : JC2 15) chain O residue 20 type sequence R description BINDING SITE FOR RESIDUE FEC P 2507 source : KC6 16) chain O residue 28 type sequence H description BINDING SITE FOR RESIDUE FEC P 2507 source : KC6 17) chain O residue 31 type sequence M description BINDING SITE FOR RESIDUE FEC P 2507 source : KC6 18) chain O residue 35 type sequence Y description BINDING SITE FOR RESIDUE FEC P 2507 source : KC6 19) chain O residue 50 type sequence K description BINDING SITE FOR RESIDUE FEC P 2507 source : KC6 20) chain O residue 57 type sequence M description BINDING SITE FOR RESIDUE FEC P 2507 source : KC6 21) chain O residue 61 type sequence E description BINDING SITE FOR RESIDUE FEC P 2507 source : KC6 22) chain O residue 168 type sequence S description BINDING SITE FOR RESIDUE FEC P 2507 source : KC6 23) chain O residue 23 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 24) chain O residue 56 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 25) chain O residue 59 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 26) chain O residue 99 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 27) chain O residue 132 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 28) chain O residue 135 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 29) chain O residue 57 type BINDING sequence M description axial binding residue source Swiss-Prot : SWS_FT_FI2

Display surface Download Links