eF-site ID 1ney-A PDB Code 1ney Chain A click to enlarge Title Triosephosphate Isomerase in Complex with DHAP Classification ISOMERASE Compound triosephosphate isomerase Source Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (TPIS_YEAST) Sequence A:  ARTFFVGGNFKLNGSKQSIKEIVERLNTASIPENVEVVIC PPATYLDYSVSLVKKPQVTVGAQNAYLKASGAFTGENSVD QIKDVGAKYVILGHSERRSYFHEDDKFIADKTKFALGQGV GVILCIGETLEEKKAGKTLDVVERQLNAVLEEVKDFTNVV VAYEPVXAIGTGLAATPEDAQDIHASIRKFLASKLGDKAA SELRILYGGSANGSNAVTFKDKADVDGFLVGGASLKPEFV DIINSRN Description Functional site 1) chain A residue 10 type sequence N description BINDING SITE FOR RESIDUE 13P A 5001 source : AC1 2) chain A residue 12 type sequence K description BINDING SITE FOR RESIDUE 13P A 5001 source : AC1 3) chain A residue 95 type sequence H description BINDING SITE FOR RESIDUE 13P A 5001 source : AC1 4) chain A residue 165 type sequence E description BINDING SITE FOR RESIDUE 13P A 5001 source : AC1 5) chain A residue 169 type sequence A description BINDING SITE FOR RESIDUE 13P A 5001 source : AC1 6) chain A residue 170 type sequence I description BINDING SITE FOR RESIDUE 13P A 5001 source : AC1 7) chain A residue 171 type sequence G description BINDING SITE FOR RESIDUE 13P A 5001 source : AC1 8) chain A residue 211 type sequence S description BINDING SITE FOR RESIDUE 13P A 5001 source : AC1 9) chain A residue 230 type sequence L description BINDING SITE FOR RESIDUE 13P A 5001 source : AC1 10) chain A residue 232 type sequence G description BINDING SITE FOR RESIDUE 13P A 5001 source : AC1 11) chain A residue 233 type sequence G description BINDING SITE FOR RESIDUE 13P A 5001 source : AC1 12) chain A residue 11 type BINDING sequence F description BINDING => ECO:0000269|PubMed:12509510 source Swiss-Prot : SWS_FT_FI3 13) chain A residue 13 type BINDING sequence L description BINDING => ECO:0000269|PubMed:12509510 source Swiss-Prot : SWS_FT_FI3 14) chain A residue 96 type ACT_SITE sequence S description Electrophile source Swiss-Prot : SWS_FT_FI1 15) chain A residue 166 type ACT_SITE sequence P description Proton acceptor source Swiss-Prot : SWS_FT_FI2 16) chain A residue 5 type MOD_RES sequence F description Phosphothreonine => ECO:0007744|PubMed:19779198 source Swiss-Prot : SWS_FT_FI4 17) chain A residue 72 type MOD_RES sequence G description Phosphoserine => ECO:0007744|PubMed:18407956, ECO:0007744|PubMed:19779198 source Swiss-Prot : SWS_FT_FI5 18) chain A residue 216 type MOD_RES sequence N description Phosphoserine => ECO:0007744|PubMed:18407956, ECO:0007744|PubMed:19779198 source Swiss-Prot : SWS_FT_FI5 19) chain A residue 224 type CROSSLNK sequence A description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0007744|PubMed:22106047 source Swiss-Prot : SWS_FT_FI6 20) chain A residue 163-173 type prosite sequence AYEPVXAIGTG description TIM_1 Triosephosphate isomerase active site. AYEPVWAIGTG source prosite : PS00171

Display surface Download Links