eF-site ID 1nek-D PDB Code 1nek Chain D click to enlarge Title Complex II (Succinate Dehydrogenase) From E. Coli with ubiquinone bound Classification OXIDOREDUCTASE/ELECTRON TRANSPORT Compound Succinate dehydrogenase flavoprotein subunit Source null (DHSD_ECOLI) Sequence D:  SNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGE LTYEVWIGFFASAFTKVFTLLALFSILIHAWIGMWQVLTD YVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV Description (1)  Succinate dehydrogenase flavoprotein subunit (E.C.1.3.99.1, 1.3.5.1), Succinate dehydrogenase iron-sulfur protein(E.C.1.3.99.1, 1.3.5.1), Succinate dehydrogenase cytochrome b-556 subunit, Succinate dehydrogenase hydrophobic membrane anchor protein Functional site 1) chain D residue 23 type sequence A description BINDING SITE FOR RESIDUE HEM C 305 source : AC8 2) chain D residue 27 type sequence T description BINDING SITE FOR RESIDUE HEM C 305 source : AC8 3) chain D residue 68 type sequence I description BINDING SITE FOR RESIDUE HEM C 305 source : AC8 4) chain D residue 71 type sequence H description BINDING SITE FOR RESIDUE HEM C 305 source : AC8 5) chain D residue 75 type sequence G description BINDING SITE FOR RESIDUE HEM C 305 source : AC8 6) chain D residue 76 type sequence M description BINDING SITE FOR RESIDUE HEM C 305 source : AC8 7) chain D residue 78 type sequence Q description BINDING SITE FOR RESIDUE HEM C 305 source : AC8 8) chain D residue 83 type sequence Y description BINDING SITE FOR RESIDUE UQ2 D 306 source : AC9 9) chain D residue 30 type sequence I description BINDING SITE FOR RESIDUE CDN C 308 source : BC1 10) chain D residue 37 type sequence F description BINDING SITE FOR RESIDUE CDN C 308 source : BC1 11) chain D residue 41 type sequence G description BINDING SITE FOR RESIDUE CDN C 308 source : BC1 12) chain D residue 43 type sequence L description BINDING SITE FOR RESIDUE CDN C 308 source : BC1 13) chain D residue 48 type sequence W description BINDING SITE FOR RESIDUE CDN C 308 source : BC1 14) chain D residue 68 type sequence I description BINDING SITE FOR RESIDUE CDN C 308 source : BC1 15) chain D residue 81-90 type TOPO_DOM sequence TDYVKPLALR description Cytoplasmic => ECO:0000305 source Swiss-Prot : SWS_FT_FI1 16) chain D residue 37-58 type TOPO_DOM sequence FATSGELTYEVWIGFFASAFTK description Periplasmic => ECO:0000305 source Swiss-Prot : SWS_FT_FI3 17) chain D residue 83 type BINDING sequence Y description BINDING => ECO:0000269|PubMed:12560550 source Swiss-Prot : SWS_FT_FI5 18) chain D residue 16-36 type TRANSMEM sequence FILVRATAIVLTLYIIYMVGF description Helical source Swiss-Prot : SWS_FT_FI2 19) chain D residue 59-80 type TRANSMEM sequence VFTLLALFSILIHAWIGMWQVL description Helical source Swiss-Prot : SWS_FT_FI2 20) chain D residue 91-115 type TRANSMEM sequence LMLQLVIVVALVVYVIYGFVVVWGV description Helical source Swiss-Prot : SWS_FT_FI2 21) chain D residue 71 type BINDING sequence H description axial binding residue source Swiss-Prot : SWS_FT_FI4

Display surface Download Links