eF-site ID 1ncr-C
PDB Code 1ncr
Chain C

click to enlarge
Title The structure of Rhinovirus 16 when complexed with pleconaril, an antiviral compound
Classification VIRUS
Compound coat protein VP1
Source ORGANISM_SCIENTIFIC: Human rhinovirus 16;
Sequence C:  GLPVYVTPGSGQFMTTDDMQSPCALPWYHPTKEIFIPGEV
KNLIEMCQVDTLIPINSTQSNIGNVSMYTVTLSPQTKLAE
EIFAIKVDIASHPLATTLIGEIASYFTHWTGSLRFSFMFC
GTANTTLKVLLAYTPPGIGKPRSRKEAMLGTHVVWDVGLQ
STVSLVVPWISASQYRFTTPDTYSSAGYITCWYQTNFVVP
PNTPNTAEMLCFVSGCKDFCLRMARDTDLHKQTGPITQ
Description (1)  Coat protein VP1/Coat protein VP2/Coat protein VP3/Coat protein VP4


Functional site

1) chain C
residue 24
type binding
ligand W11: 3-{3,5-DIMETHYL-4-[3-(3-METHYL-ISOXAZOL-5-YL)-PROPOXY]-PHENYL}-5-TRIFLUOROMETHYL-[1,2,4]OXADIAZOLE
sequence A
description 3-{3,5-DIMETHYL-4-[3-(3-METHYL-ISOXAZOL-5-YL)-PROPOXY]-PHENYL}-5-TRIFLUOROMETHYL-[1,2,4]OXADIAZOLE binding site
source pdb_hetatom : W11_1ncr_A_7001


Display surface

Download
Links