eF-site ID 1na1-C
PDB Code 1na1
Chain C

click to enlarge
Title The structure of HRV14 when complexed with Pleconaril
Classification VIRUS
Compound Coat protein VP1
Source ORGANISM_SCIENTIFIC: Human rhinovirus 14;
Sequence C:  GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKV
HNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQV
FGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGP
ALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQST
IVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPE
TTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE
Description (1)  Coat protein VP1/Coat protein VP2/Coat protein VP3/Coat protein VP4


Functional site

1) chain C
residue 24
type
ligand
sequence A
description BINDING SITE FOR RESIDUE W11 A 7001
source : AC1


Display surface

Download
Links