eF-site ID 1na1-B
PDB Code 1na1
Chain B

click to enlarge
Title The structure of HRV14 when complexed with Pleconaril
Classification VIRUS
Compound Coat protein VP1
Source ORGANISM_SCIENTIFIC: Human rhinovirus 14;
Sequence B:  GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDA
SDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALK
DMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVI
PEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVK
DVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSV
PIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPM
CTEFSGIRSKSIVPQ
Description (1)  Coat protein VP1/Coat protein VP2/Coat protein VP3/Coat protein VP4

Display surface

Download
Links