eF-site ID 1na1-D PDB Code 1na1 Chain D click to enlarge Title The structure of HRV14 when complexed with Pleconaril Classification VIRUS Compound Coat protein VP1 Source ORGANISM_SCIENTIFIC: Human rhinovirus 14; Sequence D:  INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN Description Functional site 1) chain D residue 68 type SITE sequence N description Cleavage; by autolysis => ECO:0000305|PubMed:8383233 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links