eF-site ID 1n5s-AB PDB Code 1n5s Chain A, B click to enlarge Title Crystal structure of a Monooxygenase from the gene ActVA-Orf6 of Streptomyces coelicolor in complex with the ligand Acetyl Dithranol Classification OXIDOREDUCTASE Compound ActVA-Orf6 monooxygenase Source Streptomyces coelicolor (Q53908_STRCO) Sequence A:  AEVNDPRVGFVAVVTFPVDGPATQHKLVELATGGVQEWIR EVPGFLSATYHASTDGTAVVNYAQWESEQAYRVNFGADPR SAELREALSSLPGLMGPPKAVFMTPRGAILPS B:  AEVNDPRVGFVAVVTFPVDGPATQHKLVELATGGVQEWIR EVPGFLSATYHASTDGTAVVNYAQWESEQAYRVNFGADPR SAELREALSSLPGLMGPPKAVFMTPRGAILPS Description Functional site 1) chain B residue 15 type sequence V description BINDING SITE FOR RESIDUE ADL B 1001 source : AC1 2) chain B residue 49 type sequence A description BINDING SITE FOR RESIDUE ADL B 1001 source : AC1 3) chain B residue 51 type sequence Y description BINDING SITE FOR RESIDUE ADL B 1001 source : AC1 4) chain B residue 62 type sequence N description BINDING SITE FOR RESIDUE ADL B 1001 source : AC1 5) chain B residue 64 type sequence A description BINDING SITE FOR RESIDUE ADL B 1001 source : AC1 6) chain B residue 66 type sequence W description BINDING SITE FOR RESIDUE ADL B 1001 source : AC1 7) chain B residue 72 type sequence Y description BINDING SITE FOR RESIDUE ADL B 1001 source : AC1 8) chain B residue 86 type sequence R description BINDING SITE FOR RESIDUE ADL B 1001 source : AC1 9) chain B residue 89 type sequence L description BINDING SITE FOR RESIDUE ADL B 1001 source : AC1 10) chain B residue 99 type sequence P description BINDING SITE FOR RESIDUE ADL B 1001 source : AC1 11) chain A residue 13 type sequence A description BINDING SITE FOR RESIDUE 1PG A 2001 source : AC2 12) chain A residue 37 type sequence Q description BINDING SITE FOR RESIDUE 1PG A 2001 source : AC2 13) chain A residue 40 type sequence I description BINDING SITE FOR RESIDUE 1PG A 2001 source : AC2 14) chain A residue 51 type sequence Y description BINDING SITE FOR RESIDUE 1PG A 2001 source : AC2 15) chain A residue 62 type sequence N description BINDING SITE FOR RESIDUE 1PG A 2001 source : AC2 16) chain A residue 66 type sequence W description BINDING SITE FOR RESIDUE 1PG A 2001 source : AC2 17) chain A residue 72 type sequence Y description BINDING SITE FOR RESIDUE 1PG A 2001 source : AC2 18) chain A residue 85 type sequence L description BINDING SITE FOR RESIDUE 1PG A 2001 source : AC2 19) chain A residue 86 type sequence R description BINDING SITE FOR RESIDUE 1PG A 2001 source : AC2 20) chain B residue 79 type sequence D description BINDING SITE FOR RESIDUE 1PG A 2001 source : AC2 21) chain B residue 81 type sequence R description BINDING SITE FOR RESIDUE 1PG A 2001 source : AC2

Display surface Download Links