eF-site ID 1n5q-A PDB Code 1n5q Chain A click to enlarge Title Crystal structure of a Monooxygenase from the gene ActVA-Orf6 of Streptomyces coelicolor in complex with dehydrated Sancycline Classification OXIDOREDUCTASE Compound ActaVA-Orf6 monooxygenase Source Streptomyces coelicolor (Q53908_STRCO) Sequence A:  AEVNDPRVGFVAVVTFPVDGPATQHKLVELATGGVQEWIR EVPGFLSATYHASTDGTAVVNYAQWESEQAYRVNFGADPR SAELREALSSLPGLMGPPKAVFMTPRGAILPS Description Functional site 1) chain A residue 13 type sequence A description BINDING SITE FOR RESIDUE P6G A 2001 source : AC2 2) chain A residue 15 type sequence V description BINDING SITE FOR RESIDUE P6G A 2001 source : AC2 3) chain A residue 37 type sequence Q description BINDING SITE FOR RESIDUE P6G A 2001 source : AC2 4) chain A residue 49 type sequence A description BINDING SITE FOR RESIDUE P6G A 2001 source : AC2 5) chain A residue 51 type sequence Y description BINDING SITE FOR RESIDUE P6G A 2001 source : AC2 6) chain A residue 62 type sequence N description BINDING SITE FOR RESIDUE P6G A 2001 source : AC2 7) chain A residue 64 type sequence A description BINDING SITE FOR RESIDUE P6G A 2001 source : AC2 8) chain A residue 66 type sequence W description BINDING SITE FOR RESIDUE P6G A 2001 source : AC2 9) chain A residue 72 type sequence Y description BINDING SITE FOR RESIDUE P6G A 2001 source : AC2 10) chain A residue 76 type sequence F description BINDING SITE FOR RESIDUE P6G A 2001 source : AC2 11) chain A residue 85 type sequence L description BINDING SITE FOR RESIDUE P6G A 2001 source : AC2 12) chain A residue 99 type sequence P description BINDING SITE FOR RESIDUE P6G A 2001 source : AC2

Display surface Download Links