eF-site ID 1n5n-B
PDB Code 1n5n
Chain B

click to enlarge
Title Crystal Structure of Peptide Deformylase from Pseudomonas aeruginosa
Classification HYDROLASE
Compound Peptide deformylase
Source Pseudomonas aeruginosa (DEF_PSEAE)
Sequence B:  AILNILEFPDPRLRTIAKPVEVVDDAVRQLIDDMFETMYE
APGIGLAATQVNVHKRIVVMDLSEDKSEPRVFINPEFEPL
TEEMDQYQEGCLSVPGFYENVDRPQKVRIKALDRDGNPFE
EVAEGLLAVCIQHECDHLNGKLFVDYLSTLKRDRIRKKLE
KQHR
Description (1)  Peptide deformylase (E.C.3.5.1.88)


Functional site

1) chain B
residue 51
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE ZN B 402
source : AC2

2) chain B
residue 92
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN B 402
source : AC2

3) chain B
residue 134
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN B 402
source : AC2

4) chain B
residue 138
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN B 402
source : AC2

5) chain B
residue 90
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GOL B 302
source : AC4

6) chain B
residue 91
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GOL B 302
source : AC4

7) chain B
residue 131
type
ligand
sequence C
description BINDING SITE FOR RESIDUE GOL B 302
source : AC4

8) chain B
residue 135
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GOL B 302
source : AC4

9) chain B
residue 147
type ACT_SITE
ligand
sequence Y
description By similarity.
source Swiss-Prot : SWS_FT_FI3

10) chain B
residue 104
type METAL
ligand
sequence R
description Iron (By similarity)
source Swiss-Prot : SWS_FT_FI4

11) chain B
residue 146
type METAL
ligand
sequence D
description Iron (By similarity)
source Swiss-Prot : SWS_FT_FI4

12) chain B
residue 150
type METAL
ligand
sequence T
description Iron (By similarity)
source Swiss-Prot : SWS_FT_FI4

13) chain B
residue 45-46
type binding
ligand GOL: GLYCEROL
sequence IG
description GLYCEROL binding site
source pdb_hetatom : GOL_1n5n_B_302

14) chain B
residue 89-92
type binding
ligand GOL: GLYCEROL
sequence QEGC
description GLYCEROL binding site
source pdb_hetatom : GOL_1n5n_B_302

15) chain B
residue 127
type binding
ligand GOL: GLYCEROL
sequence L
description GLYCEROL binding site
source pdb_hetatom : GOL_1n5n_B_302

16) chain B
residue 130-131
type binding
ligand GOL: GLYCEROL
sequence VC
description GLYCEROL binding site
source pdb_hetatom : GOL_1n5n_B_302

17) chain B
residue 134-135
type binding
ligand GOL: GLYCEROL
sequence HE
description GLYCEROL binding site
source pdb_hetatom : GOL_1n5n_B_302

18) chain B
residue 135
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1bs4
source CSA : CSA2

19) chain B
residue 51
type catalytic
ligand
sequence Q
description Annotated By Reference To The Literature 1bs4
source CSA : CSA2

20) chain B
residue 46
type catalytic
ligand
sequence G
description Annotated By Reference To The Literature 1bs4
source CSA : CSA2

21) chain B
residue 93
type catalytic
ligand
sequence L
description Annotated By Reference To The Literature 1bs4
source CSA : CSA2


Display surface

Download
Links