eF-site ID 1n5n-AB
PDB Code 1n5n
Chain A, B

click to enlarge
Title Crystal Structure of Peptide Deformylase from Pseudomonas aeruginosa
Classification HYDROLASE
Compound Peptide deformylase
Source Pseudomonas aeruginosa (DEF_PSEAE)
Sequence A:  MAILNILEFPDPRLRTIAKPVEVVDDAVRQLIDDMFETMY
EAPGIGLAATQVNVHKRIVVMDLSEDKSEPRVFINPEFEP
LTEEMDQYQEGCLSVPGFYENVDRPQKVRIKALDRDGNPF
EEVAEGLLAVCIQHECDHLNGKLFVDYLSTLKRDRIRKKL
EKQHRQQ
B:  AILNILEFPDPRLRTIAKPVEVVDDAVRQLIDDMFETMYE
APGIGLAATQVNVHKRIVVMDLSEDKSEPRVFINPEFEPL
TEEMDQYQEGCLSVPGFYENVDRPQKVRIKALDRDGNPFE
EVAEGLLAVCIQHECDHLNGKLFVDYLSTLKRDRIRKKLE
KQHR
Description (1)  Peptide deformylase (E.C.3.5.1.88)


Functional site

1) chain A
residue 51
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE ZN A 401
source : AC1

2) chain A
residue 92
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 401
source : AC1

3) chain A
residue 134
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN A 401
source : AC1

4) chain A
residue 138
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN A 401
source : AC1

5) chain B
residue 51
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE ZN B 402
source : AC2

6) chain B
residue 92
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN B 402
source : AC2

7) chain B
residue 134
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN B 402
source : AC2

8) chain B
residue 138
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN B 402
source : AC2

9) chain A
residue 88
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE GOL A 301
source : AC3

10) chain A
residue 90
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GOL A 301
source : AC3

11) chain A
residue 91
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GOL A 301
source : AC3

12) chain A
residue 131
type
ligand
sequence C
description BINDING SITE FOR RESIDUE GOL A 301
source : AC3

13) chain A
residue 134
type
ligand
sequence H
description BINDING SITE FOR RESIDUE GOL A 301
source : AC3

14) chain B
residue 90
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GOL B 302
source : AC4

15) chain B
residue 91
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GOL B 302
source : AC4

16) chain B
residue 131
type
ligand
sequence C
description BINDING SITE FOR RESIDUE GOL B 302
source : AC4

17) chain B
residue 135
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GOL B 302
source : AC4

18) chain A
residue 44
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GOL A 303
source : AC5

19) chain A
residue 45
type
ligand
sequence I
description BINDING SITE FOR RESIDUE GOL A 303
source : AC5

20) chain A
residue 46
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GOL A 303
source : AC5

21) chain A
residue 91
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GOL A 303
source : AC5

22) chain A
residue 92
type
ligand
sequence C
description BINDING SITE FOR RESIDUE GOL A 303
source : AC5

23) chain A
residue 93
type
ligand
sequence L
description BINDING SITE FOR RESIDUE GOL A 303
source : AC5

24) chain A
residue 147
type ACT_SITE
ligand
sequence Y
description By similarity.
source Swiss-Prot : SWS_FT_FI1

25) chain A
residue 104
type METAL
ligand
sequence R
description Iron (By similarity)
source Swiss-Prot : SWS_FT_FI2

26) chain A
residue 146
type METAL
ligand
sequence D
description Iron (By similarity)
source Swiss-Prot : SWS_FT_FI2

27) chain A
residue 150
type METAL
ligand
sequence T
description Iron (By similarity)
source Swiss-Prot : SWS_FT_FI2

28) chain B
residue 147
type ACT_SITE
ligand
sequence Y
description By similarity.
source Swiss-Prot : SWS_FT_FI3

29) chain B
residue 104
type METAL
ligand
sequence R
description Iron (By similarity)
source Swiss-Prot : SWS_FT_FI4

30) chain B
residue 146
type METAL
ligand
sequence D
description Iron (By similarity)
source Swiss-Prot : SWS_FT_FI4

31) chain B
residue 150
type METAL
ligand
sequence T
description Iron (By similarity)
source Swiss-Prot : SWS_FT_FI4

32) chain A
residue 50
type catalytic
ligand
sequence T
description Mapped from 1bs4 to 1n5n using BLAST. All catalytic residues present. Original details record follows: a catalytic site defined by CATRES, Medline 97272005, 98042282, 99218079
source extCATRES : extCATRES1

33) chain A
residue 133
type catalytic
ligand
sequence Q
description Mapped from 1bs4 to 1n5n using BLAST. All catalytic residues present. Original details record follows: a catalytic site defined by CATRES, Medline 97272005, 98042282, 99218079
source extCATRES : extCATRES1

34) chain A
residue 45
type catalytic
ligand
sequence I
description Mapped from 1bs4 to 1n5n using BLAST. All catalytic residues present. Original details record follows: a catalytic site defined by CATRES, Medline 97272005, 98042282, 99218079
source extCATRES : extCATRES1

35) chain A
residue 91
type catalytic
ligand
sequence G
description Mapped from 1bs4 to 1n5n using BLAST. All catalytic residues present. Original details record follows: a catalytic site defined by CATRES, Medline 97272005, 98042282, 99218079
source extCATRES : extCATRES1

36) chain A
residue 43-46
type binding
ligand GOL: GLYCEROL
sequence PGIG
description GLYCEROL binding site
source pdb_hetatom : GOL_1n5n_A_303

37) chain A
residue 91-93
type binding
ligand GOL: GLYCEROL
sequence GCL
description GLYCEROL binding site
source pdb_hetatom : GOL_1n5n_A_303

38) chain A
residue 99
type binding
ligand GOL: GLYCEROL
sequence Y
description GLYCEROL binding site
source pdb_hetatom : GOL_1n5n_A_303

39) chain A
residue 135
type binding
ligand GOL: GLYCEROL
sequence E
description GLYCEROL binding site
source pdb_hetatom : GOL_1n5n_A_303

40) chain A
residue 45
type binding
ligand GOL: GLYCEROL
sequence I
description GLYCEROL binding site
source pdb_hetatom : GOL_1n5n_A_301

41) chain A
residue 88-92
type binding
ligand GOL: GLYCEROL
sequence YQEGC
description GLYCEROL binding site
source pdb_hetatom : GOL_1n5n_A_301

42) chain A
residue 127
type binding
ligand GOL: GLYCEROL
sequence L
description GLYCEROL binding site
source pdb_hetatom : GOL_1n5n_A_301

43) chain A
residue 130-131
type binding
ligand GOL: GLYCEROL
sequence VC
description GLYCEROL binding site
source pdb_hetatom : GOL_1n5n_A_301

44) chain A
residue 134-135
type binding
ligand GOL: GLYCEROL
sequence HE
description GLYCEROL binding site
source pdb_hetatom : GOL_1n5n_A_301

45) chain B
residue 45-46
type binding
ligand GOL: GLYCEROL
sequence IG
description GLYCEROL binding site
source pdb_hetatom : GOL_1n5n_B_302

46) chain B
residue 89-92
type binding
ligand GOL: GLYCEROL
sequence QEGC
description GLYCEROL binding site
source pdb_hetatom : GOL_1n5n_B_302

47) chain B
residue 127
type binding
ligand GOL: GLYCEROL
sequence L
description GLYCEROL binding site
source pdb_hetatom : GOL_1n5n_B_302

48) chain B
residue 130-131
type binding
ligand GOL: GLYCEROL
sequence VC
description GLYCEROL binding site
source pdb_hetatom : GOL_1n5n_B_302

49) chain B
residue 134-135
type binding
ligand GOL: GLYCEROL
sequence HE
description GLYCEROL binding site
source pdb_hetatom : GOL_1n5n_B_302

50) chain A
residue 135
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1bs4
source CSA : CSA1

51) chain A
residue 51
type catalytic
ligand
sequence Q
description Annotated By Reference To The Literature 1bs4
source CSA : CSA1

52) chain A
residue 46
type catalytic
ligand
sequence G
description Annotated By Reference To The Literature 1bs4
source CSA : CSA1

53) chain A
residue 93
type catalytic
ligand
sequence L
description Annotated By Reference To The Literature 1bs4
source CSA : CSA1

54) chain B
residue 135
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1bs4
source CSA : CSA2

55) chain B
residue 51
type catalytic
ligand
sequence Q
description Annotated By Reference To The Literature 1bs4
source CSA : CSA2

56) chain B
residue 46
type catalytic
ligand
sequence G
description Annotated By Reference To The Literature 1bs4
source CSA : CSA2

57) chain B
residue 93
type catalytic
ligand
sequence L
description Annotated By Reference To The Literature 1bs4
source CSA : CSA2


Display surface

Download
Links