eF-site ID 1n5n-A
PDB Code 1n5n
Chain A

click to enlarge
Title Crystal Structure of Peptide Deformylase from Pseudomonas aeruginosa
Classification HYDROLASE
Compound Peptide deformylase
Source Pseudomonas aeruginosa (DEF_PSEAE)
Sequence A:  MAILNILEFPDPRLRTIAKPVEVVDDAVRQLIDDMFETMY
EAPGIGLAATQVNVHKRIVVMDLSEDKSEPRVFINPEFEP
LTEEMDQYQEGCLSVPGFYENVDRPQKVRIKALDRDGNPF
EEVAEGLLAVCIQHECDHLNGKLFVDYLSTLKRDRIRKKL
EKQHRQQ
Description (1)  Peptide deformylase (E.C.3.5.1.88)


Functional site

1) chain A
residue 51
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE ZN A 401
source : AC1

2) chain A
residue 92
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 401
source : AC1

3) chain A
residue 134
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN A 401
source : AC1

4) chain A
residue 138
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN A 401
source : AC1

5) chain A
residue 88
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE GOL A 301
source : AC3

6) chain A
residue 90
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GOL A 301
source : AC3

7) chain A
residue 91
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GOL A 301
source : AC3

8) chain A
residue 131
type
ligand
sequence C
description BINDING SITE FOR RESIDUE GOL A 301
source : AC3

9) chain A
residue 134
type
ligand
sequence H
description BINDING SITE FOR RESIDUE GOL A 301
source : AC3

10) chain A
residue 44
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GOL A 303
source : AC5

11) chain A
residue 45
type
ligand
sequence I
description BINDING SITE FOR RESIDUE GOL A 303
source : AC5

12) chain A
residue 46
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GOL A 303
source : AC5

13) chain A
residue 91
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GOL A 303
source : AC5

14) chain A
residue 92
type
ligand
sequence C
description BINDING SITE FOR RESIDUE GOL A 303
source : AC5

15) chain A
residue 93
type
ligand
sequence L
description BINDING SITE FOR RESIDUE GOL A 303
source : AC5

16) chain A
residue 147
type ACT_SITE
ligand
sequence Y
description By similarity.
source Swiss-Prot : SWS_FT_FI1

17) chain A
residue 104
type METAL
ligand
sequence R
description Iron (By similarity)
source Swiss-Prot : SWS_FT_FI2

18) chain A
residue 146
type METAL
ligand
sequence D
description Iron (By similarity)
source Swiss-Prot : SWS_FT_FI2

19) chain A
residue 150
type METAL
ligand
sequence T
description Iron (By similarity)
source Swiss-Prot : SWS_FT_FI2

20) chain A
residue 50
type catalytic
ligand
sequence T
description Mapped from 1bs4 to 1n5n using BLAST. All catalytic residues present. Original details record follows: a catalytic site defined by CATRES, Medline 97272005, 98042282, 99218079
source extCATRES : extCATRES1

21) chain A
residue 133
type catalytic
ligand
sequence Q
description Mapped from 1bs4 to 1n5n using BLAST. All catalytic residues present. Original details record follows: a catalytic site defined by CATRES, Medline 97272005, 98042282, 99218079
source extCATRES : extCATRES1

22) chain A
residue 45
type catalytic
ligand
sequence I
description Mapped from 1bs4 to 1n5n using BLAST. All catalytic residues present. Original details record follows: a catalytic site defined by CATRES, Medline 97272005, 98042282, 99218079
source extCATRES : extCATRES1

23) chain A
residue 91
type catalytic
ligand
sequence G
description Mapped from 1bs4 to 1n5n using BLAST. All catalytic residues present. Original details record follows: a catalytic site defined by CATRES, Medline 97272005, 98042282, 99218079
source extCATRES : extCATRES1

24) chain A
residue 43-46
type binding
ligand GOL: GLYCEROL
sequence PGIG
description GLYCEROL binding site
source pdb_hetatom : GOL_1n5n_A_303

25) chain A
residue 91-93
type binding
ligand GOL: GLYCEROL
sequence GCL
description GLYCEROL binding site
source pdb_hetatom : GOL_1n5n_A_303

26) chain A
residue 99
type binding
ligand GOL: GLYCEROL
sequence Y
description GLYCEROL binding site
source pdb_hetatom : GOL_1n5n_A_303

27) chain A
residue 135
type binding
ligand GOL: GLYCEROL
sequence E
description GLYCEROL binding site
source pdb_hetatom : GOL_1n5n_A_303

28) chain A
residue 45
type binding
ligand GOL: GLYCEROL
sequence I
description GLYCEROL binding site
source pdb_hetatom : GOL_1n5n_A_301

29) chain A
residue 88-92
type binding
ligand GOL: GLYCEROL
sequence YQEGC
description GLYCEROL binding site
source pdb_hetatom : GOL_1n5n_A_301

30) chain A
residue 127
type binding
ligand GOL: GLYCEROL
sequence L
description GLYCEROL binding site
source pdb_hetatom : GOL_1n5n_A_301

31) chain A
residue 130-131
type binding
ligand GOL: GLYCEROL
sequence VC
description GLYCEROL binding site
source pdb_hetatom : GOL_1n5n_A_301

32) chain A
residue 134-135
type binding
ligand GOL: GLYCEROL
sequence HE
description GLYCEROL binding site
source pdb_hetatom : GOL_1n5n_A_301

33) chain A
residue 135
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1bs4
source CSA : CSA1

34) chain A
residue 51
type catalytic
ligand
sequence Q
description Annotated By Reference To The Literature 1bs4
source CSA : CSA1

35) chain A
residue 46
type catalytic
ligand
sequence G
description Annotated By Reference To The Literature 1bs4
source CSA : CSA1

36) chain A
residue 93
type catalytic
ligand
sequence L
description Annotated By Reference To The Literature 1bs4
source CSA : CSA1


Display surface

Download
Links