eF-site ID 1n36-D PDB Code 1n36 Chain D click to enlarge Title Structure of the Thermus thermophilus 30S ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer RNA anticodon stem-loop mismatched at the second codon position Classification RIBOSOME Compound 16S RIBOSOMAL RNA Source ORGANISM_SCIENTIFIC: Thermus thermophilus; Sequence D:  GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPG QHGQKRARRPSDYAVRLREKQKLRRIYGISERQFRNLFEE ASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLV RHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQN LEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQ LVIEFYSR Description Functional site 1) chain D residue 9 type sequence C description BINDING SITE FOR RESIDUE ZN D 306 source : AC1 2) chain D residue 19 type sequence L description BINDING SITE FOR RESIDUE ZN D 306 source : AC1 3) chain D residue 22 type sequence K description BINDING SITE FOR RESIDUE ZN D 306 source : AC1 4) chain D residue 26 type sequence C description BINDING SITE FOR RESIDUE ZN D 306 source : AC1 5) chain D residue 31 type sequence C description BINDING SITE FOR RESIDUE ZN D 306 source : AC1 6) chain D residue 97-121 type prosite sequence LESRLDNVVYRLGFAVSRRQARQLV description RIBOSOMAL_S4 Ribosomal protein S4 signature. LEsRLdnvVYRlgfAvSrrqARqLV source prosite : PS00632

Display surface Download Links