eF-site ID 1n33-N PDB Code 1n33 Chain N click to enlarge Title Structure of the Thermus thermophilus 30S ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin Classification RIBOSOME Compound 16S RIBOSOMAL RNA Source ORGANISM_SCIENTIFIC: Thermus thermophilus; Sequence N:  ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCR ICLRELAHKGQLPGVRKASW Description (1)  30S Ribosomal Subunit Functional site 1) chain N residue 2 type sequence A description BINDING SITE FOR RESIDUE MG A 1618 source : HC5 2) chain N residue 24 type sequence C description BINDING SITE FOR RESIDUE ZN N 307 source : KC3 3) chain N residue 27 type sequence C description BINDING SITE FOR RESIDUE ZN N 307 source : KC3 4) chain N residue 40 type sequence C description BINDING SITE FOR RESIDUE ZN N 307 source : KC3 5) chain N residue 43 type sequence C description BINDING SITE FOR RESIDUE ZN N 307 source : KC3 6) chain N residue 25 type BINDING sequence V description BINDING => ECO:0000255|HAMAP-Rule:MF_01364 source Swiss-Prot : SWS_FT_FI1 7) chain N residue 28 type BINDING sequence G description BINDING => ECO:0000255|HAMAP-Rule:MF_01364 source Swiss-Prot : SWS_FT_FI1 8) chain N residue 41 type BINDING sequence R description BINDING => ECO:0000255|HAMAP-Rule:MF_01364 source Swiss-Prot : SWS_FT_FI1 9) chain N residue 44 type BINDING sequence L description BINDING => ECO:0000255|HAMAP-Rule:MF_01364 source Swiss-Prot : SWS_FT_FI1 10) chain N residue 24 type BINDING sequence C description BINDING => ECO:0000269|PubMed:11866529 source Swiss-Prot : SWS_FT_FI2 11) chain N residue 27 type BINDING sequence C description BINDING => ECO:0000269|PubMed:11866529 source Swiss-Prot : SWS_FT_FI2 12) chain N residue 40 type BINDING sequence C description BINDING => ECO:0000269|PubMed:11866529 source Swiss-Prot : SWS_FT_FI2 13) chain N residue 43 type BINDING sequence C description BINDING => ECO:0000269|PubMed:11866529 source Swiss-Prot : SWS_FT_FI2 14) chain N residue 23-45 type prosite sequence RCVRCGRARSVYRFFGLCRICLR description RIBOSOMAL_S14 Ribosomal protein S14 signature. R.CvrcgrarsvyrfFGLCRiCLR source prosite : PS00527

Display surface Download Links