eF-site ID 1n33-D PDB Code 1n33 Chain D click to enlarge Title Structure of the Thermus thermophilus 30S ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin Classification RIBOSOME Compound 16S RIBOSOMAL RNA Source ORGANISM_SCIENTIFIC: Thermus thermophilus; Sequence D:  GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPG QHGQKRARRPSDYAVRLREKQKLRRIYGISERQFRNLFEE ASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLV RHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQN LEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQ LVIEFYSR Description (1)  30S Ribosomal Subunit Functional site 1) chain D residue 9 type sequence C description BINDING SITE FOR RESIDUE ZN D 306 source : KC2 2) chain D residue 12 type sequence C description BINDING SITE FOR RESIDUE ZN D 306 source : KC2 3) chain D residue 22 type sequence K description BINDING SITE FOR RESIDUE ZN D 306 source : KC2 4) chain D residue 26 type sequence C description BINDING SITE FOR RESIDUE ZN D 306 source : KC2 5) chain D residue 31 type sequence C description BINDING SITE FOR RESIDUE ZN D 306 source : KC2 6) chain D residue 97-121 type prosite sequence LESRLDNVVYRLGFAVSRRQARQLV description RIBOSOMAL_S4 Ribosomal protein S4 signature. LEsRLdnvVYRlgfAvSrrqARqLV source prosite : PS00632

Display surface Download Links