eF-site ID 1n32-E PDB Code 1n32 Chain E click to enlarge Title Structure of the Thermus thermophilus 30S ribosomal subunit bound to codon and near-cognate transfer RNA anticodon stem-loop mismatched at the first codon position at the a site with paromomycin Classification RIBOSOME Compound 16S RIBOSOMAL RNA Source ORGANISM_SCIENTIFIC: Thermus thermophilus; Sequence E:  DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLG FGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEF GASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELG SRNPINIAYATMEALRQLRTKADVERLRKG Description (1)  30S Ribosomal Subunit Functional site 1) chain E residue 103 type sequence G description BINDING SITE FOR RESIDUE MG E 468 source : MC6 2) chain E residue 104 type sequence A description BINDING SITE FOR RESIDUE MG E 468 source : MC6 3) chain E residue 105 type sequence V description BINDING SITE FOR RESIDUE MG E 468 source : MC6 4) chain E residue 106 type sequence P description BINDING SITE FOR RESIDUE MG E 468 source : MC6 5) chain E residue 122 type sequence E description BINDING SITE FOR RESIDUE MG E 468 source : MC6 6) chain E residue 23-55 type prosite sequence GRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAV description RIBOSOMAL_S5 Ribosomal protein S5 signature. GRrfrFgAlvVVGDrq.GrVGlGfgkap.EVpl.AV source prosite : PS00585

Display surface Download Links