eF-site ID 1n32-D PDB Code 1n32 Chain D click to enlarge Title Structure of the Thermus thermophilus 30S ribosomal subunit bound to codon and near-cognate transfer RNA anticodon stem-loop mismatched at the first codon position at the a site with paromomycin Classification RIBOSOME Compound 16S RIBOSOMAL RNA Source ORGANISM_SCIENTIFIC: Thermus thermophilus; Sequence D:  GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPG QHGQKRARRPSDYAVRLREKQKLRRIYGISERQFRNLFEE ASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLV RHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQN LEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQ LVIEFYSR Description (1)  30S Ribosomal Subunit Functional site 1) chain D residue 82 type sequence A description BINDING SITE FOR RESIDUE MG D 215 source : GC2 2) chain D residue 83 type sequence S description BINDING SITE FOR RESIDUE MG D 215 source : GC2 3) chain D residue 85 type sequence K description BINDING SITE FOR RESIDUE MG D 215 source : GC2 4) chain D residue 87 type sequence G description BINDING SITE FOR RESIDUE MG D 215 source : GC2 5) chain D residue 89 type sequence T description BINDING SITE FOR RESIDUE MG D 215 source : GC2 6) chain D residue 9 type sequence C description BINDING SITE FOR RESIDUE ZN D 306 source : PC3 7) chain D residue 12 type sequence C description BINDING SITE FOR RESIDUE ZN D 306 source : PC3 8) chain D residue 19 type sequence L description BINDING SITE FOR RESIDUE ZN D 306 source : PC3 9) chain D residue 26 type sequence C description BINDING SITE FOR RESIDUE ZN D 306 source : PC3 10) chain D residue 31 type sequence C description BINDING SITE FOR RESIDUE ZN D 306 source : PC3 11) chain D residue 97-121 type prosite sequence LESRLDNVVYRLGFAVSRRQARQLV description RIBOSOMAL_S4 Ribosomal protein S4 signature. LEsRLdnvVYRlgfAvSrrqARqLV source prosite : PS00632

Display surface Download Links