eF-site ID 1mzr-A PDB Code 1mzr Chain A click to enlarge Title Structure of dkga from E.coli at 2.13 A resolution solved by molecular replacement Classification OXIDOREDUCTASE Compound 2,5-diketo-D-gluconate reductase A Source Escherichia coli (strain K12) (DKGA_ECOLI) Sequence A:  ANPTVIKLQDGNVMPQLGLGVWQASNEEVITAIQKALEVG YRSIDTAAAYKNEEGVGKALKNASVNREELFITTKLWNDD HKRPREALLDSLKKLQLDYIDLYLMHWPVPAIDHYVEAWK GMIELQKEGLIKSIGVCNFQIHHLQRLIDETGVTPVINQI ELHPLMQQRQLHAWNATHKIQTESWSPLAQGGKGVFDQKV IRDLADKYGKTPAQIVIRWHLDSGLVVIPKSVTPSRIAEN FDVWDFRLDKDELGEIAKLDQGKRLGPDPDQFGG Description Functional site 1) chain A residue 188 type sequence S description BINDING SITE FOR RESIDUE PO4 A 900 source : AC1 2) chain A residue 189 type sequence P description BINDING SITE FOR RESIDUE PO4 A 900 source : AC1 3) chain A residue 190 type sequence L description BINDING SITE FOR RESIDUE PO4 A 900 source : AC1 4) chain A residue 231 type sequence P description BINDING SITE FOR RESIDUE PO4 A 900 source : AC1 5) chain A residue 232 type sequence K description BINDING SITE FOR RESIDUE PO4 A 900 source : AC1 6) chain A residue 233 type sequence S description BINDING SITE FOR RESIDUE PO4 A 901 source : AC2 7) chain A residue 234 type sequence V description BINDING SITE FOR RESIDUE PO4 A 901 source : AC2 8) chain A residue 235 type sequence T description BINDING SITE FOR RESIDUE PO4 A 901 source : AC2 9) chain A residue 238 type sequence R description BINDING SITE FOR RESIDUE PO4 A 901 source : AC2 10) chain A residue 171 type sequence R description BINDING SITE FOR RESIDUE PO4 B 904 source : AC4 11) chain A residue 172 type sequence Q description BINDING SITE FOR RESIDUE PO4 B 904 source : AC4 12) chain A residue 262 type sequence D description BINDING SITE FOR RESIDUE PO4 B 904 source : AC4 13) chain A residue 24 type sequence W description BINDING SITE FOR RESIDUE GOL A 910 source : AC6 14) chain A residue 52 type sequence Y description BINDING SITE FOR RESIDUE GOL A 910 source : AC6 15) chain A residue 79 type sequence W description BINDING SITE FOR RESIDUE GOL A 910 source : AC6 16) chain A residue 108 type sequence H description BINDING SITE FOR RESIDUE GOL A 910 source : AC6 17) chain A residue 109 type sequence W description BINDING SITE FOR RESIDUE GOL A 910 source : AC6 18) chain A residue 25 type sequence Q description BINDING SITE FOR RESIDUE GOL A 911 source : AC7 19) chain A residue 79 type sequence W description BINDING SITE FOR RESIDUE GOL A 911 source : AC7 20) chain A residue 52 type ACT_SITE sequence Y description Proton donor => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 21) chain A residue 108 type BINDING sequence H description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 22) chain A residue 188 type BINDING sequence S description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 23) chain A residue 124-141 type prosite sequence MIELQKEGLIKSIGVCNF description ALDOKETO_REDUCTASE_2 Aldo/keto reductase family signature 2. MielqkeglIKSIGVCNF source prosite : PS00062 24) chain A residue 230-245 type prosite sequence IPKSVTPSRIAENFDV description ALDOKETO_REDUCTASE_3 Aldo/keto reductase family putative active site signature. IPKSVTpsRIaENfDV source prosite : PS00063 25) chain A residue 42-59 type prosite sequence GYRSIDTAAAYKNEEGVG description ALDOKETO_REDUCTASE_1 Aldo/keto reductase family signature 1. GYRSIDTAaayknEegVG source prosite : PS00798

Display surface Download Links