eF-site ID 1mwn_17-A PDB Code 1mwn Model 17 Chain A click to enlarge Title Solution NMR structure of S100B bound to the high-affinity target peptide TRTK-12 Classification STRUCTURAL PROTEIN Compound S-100 protein, beta chain Source null (CAZA1_HUMAN) Sequence A:  SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNEL SHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVSMV TTACHEFFEHE Description Functional site 1) chain A residue 18 type sequence S description BINDING SITE FOR RESIDUE CA A 100 source : AC1 2) chain A residue 23 type sequence D description BINDING SITE FOR RESIDUE CA A 100 source : AC1 3) chain A residue 24 type sequence K description BINDING SITE FOR RESIDUE CA A 100 source : AC1 4) chain A residue 26 type sequence K description BINDING SITE FOR RESIDUE CA A 100 source : AC1 5) chain A residue 27 type sequence L description BINDING SITE FOR RESIDUE CA A 100 source : AC1 6) chain A residue 31 type sequence E description BINDING SITE FOR RESIDUE CA A 100 source : AC1 7) chain A residue 61 type sequence D description BINDING SITE FOR RESIDUE CA A 101 source : AC2 8) chain A residue 63 type sequence D description BINDING SITE FOR RESIDUE CA A 101 source : AC2 9) chain A residue 65 type sequence D description BINDING SITE FOR RESIDUE CA A 101 source : AC2 10) chain A residue 67 type sequence E description BINDING SITE FOR RESIDUE CA A 101 source : AC2 11) chain A residue 72 type sequence E description BINDING SITE FOR RESIDUE CA A 101 source : AC2 12) chain A residue 2 type MOD_RES sequence E description N-acetylserine => ECO:0000250|UniProtKB:P02638 source Swiss-Prot : SWS_FT_FI4 13) chain A residue 66 type BINDING sequence G description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448, ECO:0000269|PubMed:18949447, ECO:0007744|PDB:2K7O source Swiss-Prot : SWS_FT_FI3 14) chain A residue 68 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448, ECO:0000269|PubMed:18949447, ECO:0007744|PDB:2K7O source Swiss-Prot : SWS_FT_FI3 15) chain A residue 73 type BINDING sequence F description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448, ECO:0000269|PubMed:18949447, ECO:0007744|PDB:2K7O source Swiss-Prot : SWS_FT_FI3 16) chain A residue 64 type BINDING sequence G description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448, ECO:0000269|PubMed:18949447, ECO:0007744|PDB:2K7O source Swiss-Prot : SWS_FT_FI3 17) chain A residue 62 type BINDING sequence E description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448, ECO:0000269|PubMed:18949447, ECO:0007744|PDB:2K7O source Swiss-Prot : SWS_FT_FI3 18) chain A residue 61-73 type prosite sequence DEDGDGECDFQEF description EF_HAND_1 EF-hand calcium-binding domain. DEDGDGECDfqEF source prosite : PS00018 19) chain A residue 56-77 type prosite sequence VMETLDEDGDGECDFQEFMAFV description S100_CABP S-100/ICaBP type calcium binding protein signature. VMetLDedgDgecDFqEFmaFV source prosite : PS00303 20) chain A residue 86 type BINDING sequence E description BINDING => ECO:0000305|PubMed:14621986 source Swiss-Prot : SWS_FT_FI1 21) chain A residue 91 type BINDING sequence E description BINDING => ECO:0000305|PubMed:14621986 source Swiss-Prot : SWS_FT_FI1 22) chain A residue 16 type BINDING sequence Q description BINDING => ECO:0000305|PubMed:14621986 source Swiss-Prot : SWS_FT_FI1 23) chain A residue 26 type BINDING sequence K description BINDING => ECO:0000305|PubMed:14621986 source Swiss-Prot : SWS_FT_FI1 24) chain A residue 27 type BINDING sequence L description BINDING => ECO:0000269|PubMed:18949447, ECO:0007744|PDB:2K7O source Swiss-Prot : SWS_FT_FI2 25) chain A residue 32 type BINDING sequence L description BINDING => ECO:0000269|PubMed:18949447, ECO:0007744|PDB:2K7O source Swiss-Prot : SWS_FT_FI2 26) chain A residue 19 type BINDING sequence G description BINDING => ECO:0000269|PubMed:18949447, ECO:0007744|PDB:2K7O source Swiss-Prot : SWS_FT_FI2 27) chain A residue 22 type BINDING sequence G description BINDING => ECO:0000269|PubMed:18949447, ECO:0007744|PDB:2K7O source Swiss-Prot : SWS_FT_FI2

Display surface Download Links