eF-site ID 1mwc-A
PDB Code 1mwc
Chain A

click to enlarge
Title WILD TYPE MYOGLOBIN WITH CO
Classification OXYGEN STORAGE/TRANSPORT
Compound PROTEIN (MYOGLOBIN)
Source Sus scrofa (Pig) (MYG_PIG)
Sequence A:  GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETL
EKFDKFKHLKSEDEMKASEDLKKHGNTVLTALGGILKKKG
HHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP
GDFGADAQGAMSKALELFRNDMAAKYKELGFQG
Description (1)  PROTEIN (MYOGLOBIN)


Functional site

1) chain A
residue 42
type
ligand
sequence K
description BINDING SITE FOR RESIDUE HEM A 154
source : AC1

2) chain A
residue 43
type
ligand
sequence F
description BINDING SITE FOR RESIDUE HEM A 154
source : AC1

3) chain A
residue 64
type
ligand
sequence H
description BINDING SITE FOR RESIDUE HEM A 154
source : AC1

4) chain A
residue 67
type
ligand
sequence T
description BINDING SITE FOR RESIDUE HEM A 154
source : AC1

5) chain A
residue 68
type
ligand
sequence V
description BINDING SITE FOR RESIDUE HEM A 154
source : AC1

6) chain A
residue 71
type
ligand
sequence A
description BINDING SITE FOR RESIDUE HEM A 154
source : AC1

7) chain A
residue 89
type
ligand
sequence L
description BINDING SITE FOR RESIDUE HEM A 154
source : AC1

8) chain A
residue 92
type
ligand
sequence S
description BINDING SITE FOR RESIDUE HEM A 154
source : AC1

9) chain A
residue 93
type
ligand
sequence H
description BINDING SITE FOR RESIDUE HEM A 154
source : AC1

10) chain A
residue 97
type
ligand
sequence H
description BINDING SITE FOR RESIDUE HEM A 154
source : AC1

11) chain A
residue 99
type
ligand
sequence I
description BINDING SITE FOR RESIDUE HEM A 154
source : AC1

12) chain A
residue 103
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE HEM A 154
source : AC1

13) chain A
residue 107
type
ligand
sequence I
description BINDING SITE FOR RESIDUE HEM A 154
source : AC1

14) chain A
residue 43
type
ligand
sequence F
description BINDING SITE FOR RESIDUE CMO A 155
source : AC2

15) chain A
residue 64
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CMO A 155
source : AC2

16) chain A
residue 68
type
ligand
sequence V
description BINDING SITE FOR RESIDUE CMO A 155
source : AC2

17) chain A
residue 64
type METAL
ligand
sequence H
description Iron (heme distal ligand)
source Swiss-Prot : SWS_FT_FI1

18) chain A
residue 93
type METAL
ligand
sequence H
description Iron (heme proximal ligand)
source Swiss-Prot : SWS_FT_FI2

19) chain A
residue 32
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence L
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1mwc_A_154

20) chain A
residue 39
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence T
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1mwc_A_154

21) chain A
residue 42-43
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence KF
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1mwc_A_154

22) chain A
residue 45
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence K
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1mwc_A_154

23) chain A
residue 64
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence H
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1mwc_A_154

24) chain A
residue 67-68
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence TV
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1mwc_A_154

25) chain A
residue 71-72
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence AL
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1mwc_A_154

26) chain A
residue 88-89
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence PL
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1mwc_A_154

27) chain A
residue 92-93
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence SH
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1mwc_A_154

28) chain A
residue 96-97
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence KH
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1mwc_A_154

29) chain A
residue 99
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence I
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1mwc_A_154

30) chain A
residue 103-104
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence YL
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1mwc_A_154

31) chain A
residue 107
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence I
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1mwc_A_154

32) chain A
residue 111
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence I
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1mwc_A_154

33) chain A
residue 138
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence F
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1mwc_A_154


Display surface

Download
Links