eF-site ID 1mtk-A PDB Code 1mtk Chain A click to enlarge Title PHE46(CD4) ORIENTS THE DISTAL HISTIDINE FOR HYDROGEN BONDING TO BOUND LIGANDS IN SPERM WHALE MYOGLOBIN Classification OXYGEN STORAGE Compound MYOGLOBIN Source Physeter macrocephalus (Sperm whale) (Physeter catodon) (MYG_PHYCA) Sequence A:  MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPET LEKFDRVKHLKTEAEMKASEDLKKHGVTVLTALGAILKKK GHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG Description (1)  MYOGLOBIN, PROTOPORPHYRIN IX CONTAINING FE, BOUND WATER Functional site 1) chain A residue 3 type ligand sequence S description BINDING SITE FOR RESIDUE SO4 A 156 source : AC1 2) chain A residue 4 type ligand sequence E description BINDING SITE FOR RESIDUE SO4 A 156 source : AC1 3) chain A residue 51 type ligand sequence T description BINDING SITE FOR RESIDUE SO4 A 156 source : AC1 4) chain A residue 52 type ligand sequence E description BINDING SITE FOR RESIDUE SO4 A 156 source : AC1 5) chain A residue 39 type ligand sequence T description BINDING SITE FOR RESIDUE HEM A 154 source : AC2 6) chain A residue 42 type ligand sequence K description BINDING SITE FOR RESIDUE HEM A 154 source : AC2 7) chain A residue 43 type ligand sequence F description BINDING SITE FOR RESIDUE HEM A 154 source : AC2 8) chain A residue 45 type ligand sequence R description BINDING SITE FOR RESIDUE HEM A 154 source : AC2 9) chain A residue 64 type ligand sequence H description BINDING SITE FOR RESIDUE HEM A 154 source : AC2 10) chain A residue 67 type ligand sequence T description BINDING SITE FOR RESIDUE HEM A 154 source : AC2 11) chain A residue 89 type ligand sequence L description BINDING SITE FOR RESIDUE HEM A 154 source : AC2 12) chain A residue 92 type ligand sequence S description BINDING SITE FOR RESIDUE HEM A 154 source : AC2 13) chain A residue 93 type ligand sequence H description BINDING SITE FOR RESIDUE HEM A 154 source : AC2 14) chain A residue 97 type ligand sequence H description BINDING SITE FOR RESIDUE HEM A 154 source : AC2 15) chain A residue 99 type ligand sequence I description BINDING SITE FOR RESIDUE HEM A 154 source : AC2 16) chain A residue 103 type ligand sequence Y description BINDING SITE FOR RESIDUE HEM A 154 source : AC2 17) chain A residue 65 type METAL ligand sequence G description Iron (heme distal ligand) source Swiss-Prot : SWS_FT_FI1 18) chain A residue 94 type METAL ligand sequence A description Iron (heme proximal ligand) source Swiss-Prot : SWS_FT_FI2

Display surface Download Links