eF-site ID 1mtk-A
PDB Code 1mtk
Chain A

click to enlarge
Title PHE46(CD4) ORIENTS THE DISTAL HISTIDINE FOR HYDROGEN BONDING TO BOUND LIGANDS IN SPERM WHALE MYOGLOBIN
Classification OXYGEN STORAGE
Compound MYOGLOBIN
Source Physeter macrocephalus (Sperm whale) (Physeter catodon) (MYG_PHYCA)
Sequence A:  MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPET
LEKFDRVKHLKTEAEMKASEDLKKHGVTVLTALGAILKKK
GHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH
PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG
Description (1)  MYOGLOBIN, PROTOPORPHYRIN IX CONTAINING FE, BOUND WATER


Functional site

1) chain A
residue 3
type
ligand
sequence S
description BINDING SITE FOR RESIDUE SO4 A 156
source : AC1

2) chain A
residue 4
type
ligand
sequence E
description BINDING SITE FOR RESIDUE SO4 A 156
source : AC1

3) chain A
residue 51
type
ligand
sequence T
description BINDING SITE FOR RESIDUE SO4 A 156
source : AC1

4) chain A
residue 52
type
ligand
sequence E
description BINDING SITE FOR RESIDUE SO4 A 156
source : AC1

5) chain A
residue 39
type
ligand
sequence T
description BINDING SITE FOR RESIDUE HEM A 154
source : AC2

6) chain A
residue 42
type
ligand
sequence K
description BINDING SITE FOR RESIDUE HEM A 154
source : AC2

7) chain A
residue 43
type
ligand
sequence F
description BINDING SITE FOR RESIDUE HEM A 154
source : AC2

8) chain A
residue 45
type
ligand
sequence R
description BINDING SITE FOR RESIDUE HEM A 154
source : AC2

9) chain A
residue 64
type
ligand
sequence H
description BINDING SITE FOR RESIDUE HEM A 154
source : AC2

10) chain A
residue 67
type
ligand
sequence T
description BINDING SITE FOR RESIDUE HEM A 154
source : AC2

11) chain A
residue 89
type
ligand
sequence L
description BINDING SITE FOR RESIDUE HEM A 154
source : AC2

12) chain A
residue 92
type
ligand
sequence S
description BINDING SITE FOR RESIDUE HEM A 154
source : AC2

13) chain A
residue 93
type
ligand
sequence H
description BINDING SITE FOR RESIDUE HEM A 154
source : AC2

14) chain A
residue 97
type
ligand
sequence H
description BINDING SITE FOR RESIDUE HEM A 154
source : AC2

15) chain A
residue 99
type
ligand
sequence I
description BINDING SITE FOR RESIDUE HEM A 154
source : AC2

16) chain A
residue 103
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE HEM A 154
source : AC2

17) chain A
residue 65
type METAL
ligand
sequence G
description Iron (heme distal ligand)
source Swiss-Prot : SWS_FT_FI1

18) chain A
residue 94
type METAL
ligand
sequence A
description Iron (heme proximal ligand)
source Swiss-Prot : SWS_FT_FI2


Display surface

Download
Links