eF-site ID 1mtk-A
PDB Code 1mtk
Chain A

click to enlarge
Title PHE46(CD4) ORIENTS THE DISTAL HISTIDINE FOR HYDROGEN BONDING TO BOUND LIGANDS IN SPERM WHALE MYOGLOBIN
Classification OXYGEN STORAGE
Compound MYOGLOBIN
Source Physeter macrocephalus (Sperm whale) (Physeter catodon) (MYG_PHYCA)
Sequence A:  MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPET
LEKFDRVKHLKTEAEMKASEDLKKHGVTVLTALGAILKKK
GHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH
PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG
Description (1)  MYOGLOBIN, PROTOPORPHYRIN IX CONTAINING FE, BOUND WATER


Functional site

1) chain A
residue 3
type
ligand
sequence S
description BINDING SITE FOR RESIDUE SO4 A 156
source : AC1

2) chain A
residue 4
type
ligand
sequence E
description BINDING SITE FOR RESIDUE SO4 A 156
source : AC1

3) chain A
residue 51
type
ligand
sequence T
description BINDING SITE FOR RESIDUE SO4 A 156
source : AC1

4) chain A
residue 52
type
ligand
sequence E
description BINDING SITE FOR RESIDUE SO4 A 156
source : AC1

5) chain A
residue 39
type
ligand
sequence T
description BINDING SITE FOR RESIDUE HEM A 154
source : AC2

6) chain A
residue 42
type
ligand
sequence K
description BINDING SITE FOR RESIDUE HEM A 154
source : AC2

7) chain A
residue 43
type
ligand
sequence F
description BINDING SITE FOR RESIDUE HEM A 154
source : AC2

8) chain A
residue 45
type
ligand
sequence R
description BINDING SITE FOR RESIDUE HEM A 154
source : AC2

9) chain A
residue 64
type
ligand
sequence H
description BINDING SITE FOR RESIDUE HEM A 154
source : AC2

10) chain A
residue 67
type
ligand
sequence T
description BINDING SITE FOR RESIDUE HEM A 154
source : AC2

11) chain A
residue 89
type
ligand
sequence L
description BINDING SITE FOR RESIDUE HEM A 154
source : AC2

12) chain A
residue 92
type
ligand
sequence S
description BINDING SITE FOR RESIDUE HEM A 154
source : AC2

13) chain A
residue 93
type
ligand
sequence H
description BINDING SITE FOR RESIDUE HEM A 154
source : AC2

14) chain A
residue 97
type
ligand
sequence H
description BINDING SITE FOR RESIDUE HEM A 154
source : AC2

15) chain A
residue 99
type
ligand
sequence I
description BINDING SITE FOR RESIDUE HEM A 154
source : AC2

16) chain A
residue 103
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE HEM A 154
source : AC2

17) chain A
residue 65
type METAL
ligand
sequence G
description Iron (heme distal ligand)
source Swiss-Prot : SWS_FT_FI1

18) chain A
residue 94
type METAL
ligand
sequence A
description Iron (heme proximal ligand)
source Swiss-Prot : SWS_FT_FI2

19) chain A
residue 32
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence L
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1mtk_A_154

20) chain A
residue 39
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence T
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1mtk_A_154

21) chain A
residue 42-45
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence KFDR
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1mtk_A_154

22) chain A
residue 64
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence H
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1mtk_A_154

23) chain A
residue 67-68
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence TV
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1mtk_A_154

24) chain A
residue 71-72
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence AL
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1mtk_A_154

25) chain A
residue 75
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence I
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1mtk_A_154

26) chain A
residue 88-89
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence PL
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1mtk_A_154

27) chain A
residue 92-93
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence SH
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1mtk_A_154

28) chain A
residue 97
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence H
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1mtk_A_154

29) chain A
residue 99
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence I
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1mtk_A_154

30) chain A
residue 103-104
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence YL
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1mtk_A_154

31) chain A
residue 107
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence I
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1mtk_A_154

32) chain A
residue 111
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence I
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1mtk_A_154

33) chain A
residue 138
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence F
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1mtk_A_154


Display surface

Download
Links