eF-site ID 1mt6-A PDB Code 1mt6 Chain A click to enlarge Title Structure of histone H3 K4-specific methyltransferase SET7/9 with AdoHcy Classification TRANSFERASE Compound SET9 Source Homo sapiens (Human) (SET7_HUMAN) Sequence A:  TLEGYYVDDALQGQGVYTYEDGGVLQGTYVDGELNGPAQE YDTDGRLIFKGQYKDNIRHGVCWIYYPDGGSLVGEVNEDG EMTGEKIAYVYPDERTALYGKFIDGEMIEGKLATLMSTEE GRPHFELMPGNSVYHFDKSTSSCISTNALLPDPYESERVY VAESLISSAGEGLFSKVAVGPNTVMSFYNGVRITHQEVDS RDWALNGNTLSLDEETVIDVPEPYNHVSKYCASLGHKANH SFTPNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYGY Description Functional site 1) chain A residue 226 type sequence A description BINDING SITE FOR RESIDUE SAH A 1 source : AC1 2) chain A residue 228 type sequence E description BINDING SITE FOR RESIDUE SAH A 1 source : AC1 3) chain A residue 265 type sequence N description BINDING SITE FOR RESIDUE SAH A 1 source : AC1 4) chain A residue 293 type sequence H description BINDING SITE FOR RESIDUE SAH A 1 source : AC1 5) chain A residue 294 type sequence K description BINDING SITE FOR RESIDUE SAH A 1 source : AC1 6) chain A residue 295 type sequence A description BINDING SITE FOR RESIDUE SAH A 1 source : AC1 7) chain A residue 296 type sequence N description BINDING SITE FOR RESIDUE SAH A 1 source : AC1 8) chain A residue 297 type sequence H description BINDING SITE FOR RESIDUE SAH A 1 source : AC1 9) chain A residue 335 type sequence Y description BINDING SITE FOR RESIDUE SAH A 1 source : AC1 10) chain A residue 245 type catalytic sequence Y description 350 source MCSA : MCSA1 11) chain A residue 293 type catalytic sequence H description 350 source MCSA : MCSA1 12) chain A residue 297 type catalytic sequence H description 350 source MCSA : MCSA1 13) chain A residue 305 type catalytic sequence Y description 350 source MCSA : MCSA1 14) chain A residue 335 type catalytic sequence Y description 350 source MCSA : MCSA1 15) chain A residue 245 type SITE sequence Y description Histone H3K4 binding => ECO:0000269|PubMed:12540855 source Swiss-Prot : SWS_FT_FI2 16) chain A residue 256 type SITE sequence D description Histone H3K4 binding => ECO:0000269|PubMed:12540855 source Swiss-Prot : SWS_FT_FI2 17) chain A residue 266 type SITE sequence T description Histone H3K4 binding => ECO:0000269|PubMed:12540855 source Swiss-Prot : SWS_FT_FI2 18) chain A residue 317 type SITE sequence K description Histone H3K4 binding => ECO:0000269|PubMed:12540855 source Swiss-Prot : SWS_FT_FI2 19) chain A residue 335 type SITE sequence Y description Histone H3K4 binding => ECO:0000269|PubMed:12540855 source Swiss-Prot : SWS_FT_FI2 20) chain A residue 226 type BINDING sequence A description BINDING => ECO:0000269|PubMed:12514135, ECO:0000269|PubMed:12540855 source Swiss-Prot : SWS_FT_FI1 21) chain A residue 296 type BINDING sequence N description BINDING => ECO:0000269|PubMed:12514135, ECO:0000269|PubMed:12540855 source Swiss-Prot : SWS_FT_FI1 22) chain A residue 297 type BINDING sequence H description BINDING => ECO:0000269|PubMed:12514135, ECO:0000269|PubMed:12540855 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links