eF-site ID 1mn9-A PDB Code 1mn9 Chain A click to enlarge Title NDP kinase mutant (H122G) complex with RTP Classification TRANSFERASE Compound NDP kinase Source Dictyostelium discoideum (Slime mold) (NDKC_DICDI) Sequence A:  VNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQL VPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGK GVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIGGSD SVESANREIALWFKPEELLTEVKPNPNLYE Description Functional site 1) chain A residue 16 type sequence K description BINDING SITE FOR RESIDUE RTP A 160 source : AC4 2) chain A residue 56 type sequence Y description BINDING SITE FOR RESIDUE RTP A 160 source : AC4 3) chain A residue 59 type sequence H description BINDING SITE FOR RESIDUE RTP A 160 source : AC4 4) chain A residue 64 type sequence F description BINDING SITE FOR RESIDUE RTP A 160 source : AC4 5) chain A residue 68 type sequence L description BINDING SITE FOR RESIDUE RTP A 160 source : AC4 6) chain A residue 92 type sequence R description BINDING SITE FOR RESIDUE RTP A 160 source : AC4 7) chain A residue 98 type sequence T description BINDING SITE FOR RESIDUE RTP A 160 source : AC4 8) chain A residue 109 type sequence R description BINDING SITE FOR RESIDUE RTP A 160 source : AC4 9) chain A residue 116 type sequence V description BINDING SITE FOR RESIDUE RTP A 160 source : AC4 10) chain A residue 119 type sequence N description BINDING SITE FOR RESIDUE RTP A 160 source : AC4 11) chain A residue 122 type sequence G description BINDING SITE FOR RESIDUE RTP A 160 source : AC4 12) chain A residue 123 type sequence G description BINDING SITE FOR RESIDUE RTP A 160 source : AC4 13) chain A residue 16 type catalytic sequence K description 150 source MCSA : MCSA1 14) chain A residue 56 type catalytic sequence Y description 150 source MCSA : MCSA1 15) chain A residue 119 type catalytic sequence N description 150 source MCSA : MCSA1 16) chain A residue 122 type catalytic sequence G description 150 source MCSA : MCSA1 17) chain A residue 133 type catalytic sequence E description 150 source MCSA : MCSA1 18) chain A residue 122 type ACT_SITE sequence G description Pros-phosphohistidine intermediate source Swiss-Prot : SWS_FT_FI1 19) chain A residue 16 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 20) chain A residue 64 type BINDING sequence F description source Swiss-Prot : SWS_FT_FI2 21) chain A residue 92 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 22) chain A residue 98 type BINDING sequence T description source Swiss-Prot : SWS_FT_FI2 23) chain A residue 109 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 24) chain A residue 119 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2

Display surface Download Links