eF-site ID 1mm2_7-A PDB Code 1mm2 Model 7 Chain A click to enlarge Title Solution structure of the 2nd PHD domain from Mi2b Classification DNA BINDING PROTEIN Compound Mi2-beta Source null (CHD4_HUMAN) Sequence A:  GPLGSDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPL PEIPNGEWLCPRCTCPALKGK Description Functional site 1) chain A residue 24 type sequence C description BINDING SITE FOR RESIDUE ZN A 62 source : AC1 2) chain A residue 27 type sequence C description BINDING SITE FOR RESIDUE ZN A 62 source : AC1 3) chain A residue 50 type sequence C description BINDING SITE FOR RESIDUE ZN A 62 source : AC1 4) chain A residue 53 type sequence C description BINDING SITE FOR RESIDUE ZN A 62 source : AC1 5) chain A residue 12 type sequence C description BINDING SITE FOR RESIDUE ZN A 63 source : AC2 6) chain A residue 15 type sequence C description BINDING SITE FOR RESIDUE ZN A 63 source : AC2 7) chain A residue 32 type sequence H description BINDING SITE FOR RESIDUE ZN A 63 source : AC2 8) chain A residue 35 type sequence C description BINDING SITE FOR RESIDUE ZN A 63 source : AC2 9) chain A residue 9-56 type ZN_FING sequence MEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEW LCPRCTCP description PHD-type 2 => ECO:0000255|PROSITE-ProRule:PRU00146 source Swiss-Prot : SWS_FT_FI1 10) chain A residue 12-53 type prosite sequence CRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCP RC description ZF_PHD_1 Zinc finger PHD-type signature. CrvCkdggel.......................................LcCdt..Cpss.YHihClnpplpeipnge.................................WlCprC source prosite : PS01359

Display surface Download Links