eF-site ID 1mjx-B
PDB Code 1mjx
Chain B

click to enlarge
Title STRUCTURE OF INORGANIC PYROPHOSPHATASE MUTANT D65N
Classification HYDROLASE
Compound INORGANIC PYROPHOSPHATASE
Source Escherichia coli (strain K12) (IPYR_ECOLI)
Sequence B:  SLLNVPAGKDLPEDIYVVIEIPANADPIKYEIDKESGALF
VDRFMSTAMFYPCNYGYINHTLSLNGDPVDVLVPTPYPLQ
PGSVIRCRPVGVLKMTDEAGEDAKLVAVPHSKLSKEYDHI
KDVNDLPELLKAQIAHFFEHYKDLEKGKWVKVEGWENAEA
AKAEIVASFERAKNK
Description (1)  INORGANIC PYROPHOSPHATASE


Functional site

1) chain B
residue 43
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 B 176
source : AC2

2) chain B
residue 141
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE SO4 B 176
source : AC2

3) chain B
residue 142
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SO4 B 176
source : AC2

4) chain B
residue 65
type METAL
ligand
sequence N
description Magnesium 1
source Swiss-Prot : SWS_FT_FI3

5) chain B
residue 70
type METAL
ligand
sequence D
description Magnesium 1
source Swiss-Prot : SWS_FT_FI3

6) chain B
residue 102
type METAL
ligand
sequence D
description Magnesium 1
source Swiss-Prot : SWS_FT_FI3

7) chain B
residue 70
type METAL
ligand
sequence D
description Magnesium 2
source Swiss-Prot : SWS_FT_FI4

8) chain B
residue 67
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1wgi
source CSA : CSA2


Display surface

Download
Links