eF-site ID 1mjx-AB
PDB Code 1mjx
Chain A, B

click to enlarge
Title STRUCTURE OF INORGANIC PYROPHOSPHATASE MUTANT D65N
Classification HYDROLASE
Compound INORGANIC PYROPHOSPHATASE
Source Escherichia coli (strain K12) (IPYR_ECOLI)
Sequence A:  SLLNVPAGKDLPEDIYVVIEIPANADPIKYEIDKESGALF
VDRFMSTAMFYPCNYGYINHTLSLNGDPVDVLVPTPYPLQ
PGSVIRCRPVGVLKMTDEAGEDAKLVAVPHSKLSKEYDHI
KDVNDLPELLKAQIAHFFEHYKDLEKGKWVKVEGWENAEA
AKAEIVASFERAKNK
B:  SLLNVPAGKDLPEDIYVVIEIPANADPIKYEIDKESGALF
VDRFMSTAMFYPCNYGYINHTLSLNGDPVDVLVPTPYPLQ
PGSVIRCRPVGVLKMTDEAGEDAKLVAVPHSKLSKEYDHI
KDVNDLPELLKAQIAHFFEHYKDLEKGKWVKVEGWENAEA
AKAEIVASFERAKNK
Description (1)  INORGANIC PYROPHOSPHATASE


Functional site

1) chain A
residue 29
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SO4 A 176
source : AC1

2) chain A
residue 43
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 A 176
source : AC1

3) chain A
residue 141
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE SO4 A 176
source : AC1

4) chain A
residue 142
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SO4 A 176
source : AC1

5) chain B
residue 43
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 B 176
source : AC2

6) chain B
residue 141
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE SO4 B 176
source : AC2

7) chain B
residue 142
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SO4 B 176
source : AC2

8) chain A
residue 65
type METAL
ligand
sequence N
description Magnesium 1
source Swiss-Prot : SWS_FT_FI1

9) chain A
residue 70
type METAL
ligand
sequence D
description Magnesium 1
source Swiss-Prot : SWS_FT_FI1

10) chain A
residue 102
type METAL
ligand
sequence D
description Magnesium 1
source Swiss-Prot : SWS_FT_FI1

11) chain A
residue 70
type METAL
ligand
sequence D
description Magnesium 2
source Swiss-Prot : SWS_FT_FI2

12) chain B
residue 65
type METAL
ligand
sequence N
description Magnesium 1
source Swiss-Prot : SWS_FT_FI3

13) chain B
residue 70
type METAL
ligand
sequence D
description Magnesium 1
source Swiss-Prot : SWS_FT_FI3

14) chain B
residue 102
type METAL
ligand
sequence D
description Magnesium 1
source Swiss-Prot : SWS_FT_FI3

15) chain B
residue 70
type METAL
ligand
sequence D
description Magnesium 2
source Swiss-Prot : SWS_FT_FI4

16) chain A
residue 67
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1wgi
source CSA : CSA1

17) chain B
residue 67
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1wgi
source CSA : CSA2


Display surface

Download
Links