eF-site ID 1mg6-A PDB Code 1mg6 Chain A click to enlarge Title The Crystal Structure of a K49 PLA2 from the Snake Venom of Agkistrodon acutus Classification HYDROLASE Compound PHOSPHOLIPASE A2 Source ORGANISM_COMMON: Chinese moccasin; ORGANISM_SCIENTIFIC: Deinagkistrodon acutus; Sequence A:  SLFELGKMIWQETGKNPVKNYGLYGCNCGVGGRGEPLDAT DRCCFVHKCCYKKLTDCDSKKDRYSYKWKNKAIVCGKNQP CMQEMCECDKAFAICLRENLDTYNKSFRYHLKPSCKKTSE QC Description (1)  PHOSPHOLIPASE A2 (E.C.3.1.1.4) Functional site 1) chain A residue 44-51 type prosite sequence CCFVHKCC description PA2_HIS Phospholipase A2 histidine active site. CCFvHKcC source prosite : PS00118 2) chain A residue 95-105 type prosite sequence MCECDKAFAIC description PA2_ASP Phospholipase A2 aspartic acid active site. MCECDKAFaIC source prosite : PS00119 3) chain A residue 115 type SITE sequence K description Important residue of the cationic membrane-docking site (MDoS) => ECO:0000250|UniProtKB:I6L8L6 source Swiss-Prot : SWS_FT_FI1 4) chain A residue 118 type SITE sequence R description Important residue of the cationic membrane-docking site (MDoS) => ECO:0000250|UniProtKB:I6L8L6 source Swiss-Prot : SWS_FT_FI1 5) chain A residue 121 type SITE sequence L description Hydrophobic membrane-disruption site (MDiS) => ECO:0000250|UniProtKB:I6L8L6 source Swiss-Prot : SWS_FT_FI2 6) chain A residue 122 type SITE sequence K description Cationic membrane-docking site (MDoS) => ECO:0000250|UniProtKB:I6L8L6 source Swiss-Prot : SWS_FT_FI3 7) chain A residue 129 type SITE sequence K description Cationic membrane-docking site (MDoS) => ECO:0000250|UniProtKB:I6L8L6 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links