eF-site ID 1mfr-W PDB Code 1mfr Chain W click to enlarge Title CRYSTAL STRUCTURE OF M FERRITIN Classification IRON STORAGE Compound M FERRITIN Source null (FRI2_RANCA) Sequence W:  VSQVRQNYHSDCEAAVNRMLNLELYASYTYSSMYAFFDRD DVALHNVAEFFKEHSHEEREHAEKFMKYQNKRGGRVVLQD IKKPERDEWGNTLEAMQAALQLEKTVNQALLDLHKLATDK VDPHLCDFLESEYLEEQVKDIKRIGDFITNLKRLGLPENG MGEYLFDKHSV Description Functional site 1) chain W residue 23 type sequence E description BINDING SITE FOR RESIDUE MG W 176 source : EC9 2) chain W residue 58 type sequence E description BINDING SITE FOR RESIDUE MG W 176 source : EC9 3) chain W residue 61 type sequence H description BINDING SITE FOR RESIDUE MG W 176 source : EC9 4) chain W residue 137 type sequence Q description BINDING SITE FOR RESIDUE MG W 176 source : EC9 5) chain W residue 58 type sequence E description BINDING SITE FOR RESIDUE MG W 177 source : FC1 6) chain W residue 103 type sequence E description BINDING SITE FOR RESIDUE MG W 177 source : FC1 7) chain W residue 137 type sequence Q description BINDING SITE FOR RESIDUE MG W 177 source : FC1 8) chain W residue 140 type sequence D description BINDING SITE FOR RESIDUE MG W 177 source : FC1 9) chain W residue 23 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 10) chain W residue 58 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 11) chain W residue 61 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 12) chain W residue 103 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 13) chain W residue 137 type BINDING sequence Q description source Swiss-Prot : SWS_FT_FI1 14) chain W residue 140 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links