eF-site ID 1mfr-U PDB Code 1mfr Chain U click to enlarge Title CRYSTAL STRUCTURE OF M FERRITIN Classification IRON STORAGE Compound M FERRITIN Source Rana catesbeiana (American bullfrog) (Lithobates catesbeiana) (FRI2_RANCA) Sequence U:  VSQVRQNYHSDCEAAVNRMLNLELYASYTYSSMYAFFDRD DVALHNVAEFFKEHSHEEREHAEKFMKYQNKRGGRVVLQD IKKPERDEWGNTLEAMQAALQLEKTVNQALLDLHKLATDK VDPHLCDFLESEYLEEQVKDIKRIGDFITNLKRLGLPENG MGEYLFDKHSV Description Functional site 1) chain U residue 23 type sequence E description BINDING SITE FOR RESIDUE MG U 176 source : EC5 2) chain U residue 58 type sequence E description BINDING SITE FOR RESIDUE MG U 176 source : EC5 3) chain U residue 61 type sequence H description BINDING SITE FOR RESIDUE MG U 176 source : EC5 4) chain U residue 137 type sequence Q description BINDING SITE FOR RESIDUE MG U 176 source : EC5 5) chain U residue 58 type sequence E description BINDING SITE FOR RESIDUE MG U 177 source : EC6 6) chain U residue 103 type sequence E description BINDING SITE FOR RESIDUE MG U 177 source : EC6 7) chain U residue 137 type sequence Q description BINDING SITE FOR RESIDUE MG U 177 source : EC6 8) chain U residue 140 type sequence D description BINDING SITE FOR RESIDUE MG U 177 source : EC6 9) chain U residue 23 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 10) chain U residue 58 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 11) chain U residue 61 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 12) chain U residue 103 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 13) chain U residue 137 type BINDING sequence Q description source Swiss-Prot : SWS_FT_FI1 14) chain U residue 140 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links