eF-site ID 1mfr-T PDB Code 1mfr Chain T click to enlarge Title CRYSTAL STRUCTURE OF M FERRITIN Classification IRON STORAGE Compound M FERRITIN Source null (FRI2_RANCA) Sequence T:  VSQVRQNYHSDCEAAVNRMLNLELYASYTYSSMYAFFDRD DVALHNVAEFFKEHSHEEREHAEKFMKYQNKRGGRVVLQD IKKPERDEWGNTLEAMQAALQLEKTVNQALLDLHKLATDK VDPHLCDFLESEYLEEQVKDIKRIGDFITNLKRLGLPENG MGEYLFDKHSV Description Functional site 1) chain T residue 23 type sequence E description BINDING SITE FOR RESIDUE MG T 176 source : EC3 2) chain T residue 58 type sequence E description BINDING SITE FOR RESIDUE MG T 176 source : EC3 3) chain T residue 61 type sequence H description BINDING SITE FOR RESIDUE MG T 176 source : EC3 4) chain T residue 137 type sequence Q description BINDING SITE FOR RESIDUE MG T 176 source : EC3 5) chain T residue 58 type sequence E description BINDING SITE FOR RESIDUE MG T 177 source : EC4 6) chain T residue 103 type sequence E description BINDING SITE FOR RESIDUE MG T 177 source : EC4 7) chain T residue 137 type sequence Q description BINDING SITE FOR RESIDUE MG T 177 source : EC4 8) chain T residue 140 type sequence D description BINDING SITE FOR RESIDUE MG T 177 source : EC4 9) chain T residue 23 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 10) chain T residue 58 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 11) chain T residue 61 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 12) chain T residue 103 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 13) chain T residue 137 type BINDING sequence Q description source Swiss-Prot : SWS_FT_FI1 14) chain T residue 140 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links