eF-site ID 1mfr-S PDB Code 1mfr Chain S click to enlarge Title CRYSTAL STRUCTURE OF M FERRITIN Classification IRON STORAGE Compound M FERRITIN Source Rana catesbeiana (American bullfrog) (Lithobates catesbeiana) (FRI2_RANCA) Sequence S:  VSQVRQNYHSDCEAAVNRMLNLELYASYTYSSMYAFFDRD DVALHNVAEFFKEHSHEEREHAEKFMKYQNKRGGRVVLQD IKKPERDEWGNTLEAMQAALQLEKTVNQALLDLHKLATDK VDPHLCDFLESEYLEEQVKDIKRIGDFITNLKRLGLPENG MGEYLFDKHSV Description Functional site 1) chain S residue 23 type sequence E description BINDING SITE FOR RESIDUE MG S 176 source : EC1 2) chain S residue 58 type sequence E description BINDING SITE FOR RESIDUE MG S 176 source : EC1 3) chain S residue 61 type sequence H description BINDING SITE FOR RESIDUE MG S 176 source : EC1 4) chain S residue 137 type sequence Q description BINDING SITE FOR RESIDUE MG S 176 source : EC1 5) chain S residue 58 type sequence E description BINDING SITE FOR RESIDUE MG S 177 source : EC2 6) chain S residue 103 type sequence E description BINDING SITE FOR RESIDUE MG S 177 source : EC2 7) chain S residue 137 type sequence Q description BINDING SITE FOR RESIDUE MG S 177 source : EC2 8) chain S residue 140 type sequence D description BINDING SITE FOR RESIDUE MG S 177 source : EC2 9) chain S residue 23 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 10) chain S residue 58 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 11) chain S residue 61 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 12) chain S residue 103 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 13) chain S residue 137 type BINDING sequence Q description source Swiss-Prot : SWS_FT_FI1 14) chain S residue 140 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links