eF-site ID 1mfr-R PDB Code 1mfr Chain R click to enlarge Title CRYSTAL STRUCTURE OF M FERRITIN Classification IRON STORAGE Compound M FERRITIN Source Rana catesbeiana (American bullfrog) (Lithobates catesbeiana) (FRI2_RANCA) Sequence R:  VSQVRQNYHSDCEAAVNRMLNLELYASYTYSSMYAFFDRD DVALHNVAEFFKEHSHEEREHAEKFMKYQNKRGGRVVLQD IKKPERDEWGNTLEAMQAALQLEKTVNQALLDLHKLATDK VDPHLCDFLESEYLEEQVKDIKRIGDFITNLKRLGLPENG MGEYLFDKHSV Description Functional site 1) chain R residue 23 type sequence E description BINDING SITE FOR RESIDUE MG R 176 source : DC8 2) chain R residue 58 type sequence E description BINDING SITE FOR RESIDUE MG R 176 source : DC8 3) chain R residue 61 type sequence H description BINDING SITE FOR RESIDUE MG R 176 source : DC8 4) chain R residue 137 type sequence Q description BINDING SITE FOR RESIDUE MG R 176 source : DC8 5) chain R residue 58 type sequence E description BINDING SITE FOR RESIDUE MG R 177 source : DC9 6) chain R residue 103 type sequence E description BINDING SITE FOR RESIDUE MG R 177 source : DC9 7) chain R residue 137 type sequence Q description BINDING SITE FOR RESIDUE MG R 177 source : DC9 8) chain R residue 140 type sequence D description BINDING SITE FOR RESIDUE MG R 177 source : DC9 9) chain R residue 23 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 10) chain R residue 58 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 11) chain R residue 61 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 12) chain R residue 103 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 13) chain R residue 137 type BINDING sequence Q description source Swiss-Prot : SWS_FT_FI1 14) chain R residue 140 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links