eF-site ID 1mfr-Q PDB Code 1mfr Chain Q click to enlarge Title CRYSTAL STRUCTURE OF M FERRITIN Classification IRON STORAGE Compound M FERRITIN Source Rana catesbeiana (American bullfrog) (Lithobates catesbeiana) (FRI2_RANCA) Sequence Q:  VSQVRQNYHSDCEAAVNRMLNLELYASYTYSSMYAFFDRD DVALHNVAEFFKEHSHEEREHAEKFMKYQNKRGGRVVLQD IKKPERDEWGNTLEAMQAALQLEKTVNQALLDLHKLATDK VDPHLCDFLESEYLEEQVKDIKRIGDFITNLKRLGLPENG MGEYLFDKHSV Description Functional site 1) chain Q residue 23 type sequence E description BINDING SITE FOR RESIDUE MG Q 176 source : DC6 2) chain Q residue 58 type sequence E description BINDING SITE FOR RESIDUE MG Q 176 source : DC6 3) chain Q residue 61 type sequence H description BINDING SITE FOR RESIDUE MG Q 176 source : DC6 4) chain Q residue 137 type sequence Q description BINDING SITE FOR RESIDUE MG Q 176 source : DC6 5) chain Q residue 58 type sequence E description BINDING SITE FOR RESIDUE MG Q 177 source : DC7 6) chain Q residue 103 type sequence E description BINDING SITE FOR RESIDUE MG Q 177 source : DC7 7) chain Q residue 137 type sequence Q description BINDING SITE FOR RESIDUE MG Q 177 source : DC7 8) chain Q residue 140 type sequence D description BINDING SITE FOR RESIDUE MG Q 177 source : DC7 9) chain Q residue 103 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 10) chain Q residue 137 type BINDING sequence Q description source Swiss-Prot : SWS_FT_FI1 11) chain Q residue 140 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI1 12) chain Q residue 23 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 13) chain Q residue 58 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 14) chain Q residue 61 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links